{ "uniprot_canonical_ac": "Q61125-1", "uniprot_ac": "Q61125", "uniprot_id": "BKRB1_MOUSE", "mass": { "chemical_mass": 37886.0, "monoisotopic_mass": 37886.0 }, "refseq": { "ac": "NP_031565", "name": "B1 bradykinin receptor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031565" }, "gene_names": [ { "name": "Bdkrb1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q61125", "id": "Q61125" }, { "name": "B1BKR; B1R; Bdkrb; BKR1; BRADYB1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031565", "id": "NP_031565" }, { "name": "Bdkrb1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031565", "id": "NP_031565" }, { "name": "Bdkrb", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q61125", "id": "Q61125" } ], "protein_names": [ { "name": "B1 bradykinin receptor", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q61125" }, { "name": "B1 bradykinin receptor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031565", "id": "NP_031565" }, { "name": "B1R", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q61125" }, { "name": "BK-1 receptor; kinin B1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031565", "id": "NP_031565" }, { "name": "BK-1 receptor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q61125" } ], "function": [ { "annotation": "Blockade of the kinin B1 receptor counteracts the depressive-like behaviour and mechanical allodynia in ovariectomised mice.", "evidence": [ { "database": "RefSeq", "id": "NP_031565", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031565" }, { "database": "PubMed", "id": "34197868", "url": "https://glygen.org/publication/PubMed/34197868" } ] }, { "annotation": "Bradykinin Receptors Play a Critical Role in the Chronic Post-ischaemia Pain Model.", "evidence": [ { "database": "RefSeq", "id": "NP_031565", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031565" }, { "database": "PubMed", "id": "32222846", "url": "https://glygen.org/publication/PubMed/32222846" } ] }, { "annotation": "Hypothalamic kinin B1 receptor mediates orexin system hyperactivity in neurogenic hypertension. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_031565", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031565" }, { "database": "PubMed", "id": "34702886", "url": "https://glygen.org/publication/PubMed/34702886" } ] }, { "annotation": "Kinin B1 receptor deficiency protects mice fed by cafeteria diet from abnormal glucose homeostasis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_031565", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031565" }, { "database": "PubMed", "id": "35617279", "url": "https://glygen.org/publication/PubMed/35617279" } ] }, { "annotation": "This is a receptor for bradykinin. Could be a factor in chronic pain and inflammation.", "evidence": [ { "database": "UniProtKB", "id": "S4R1G8", "url": "https://www.uniprot.org/uniprot/S4R1G8#function" }, { "database": "UniProtKB", "id": "ARBA00025112", "url": "https://www.uniprot.org/uniprot/ARBA00025112#function" }, { "database": "UniProtKB", "id": "Q61125", "url": "https://www.uniprot.org/uniprot/Q61125#function" }, { "database": "UniProtKB", "id": "P46663", "url": "https://www.uniprot.org/uniprot/P46663#function" } ] } ], "disease": [ { "disease_id": "DOID:0070355", "recommended_name": { "id": "DOID:0070355", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070355", "name": "overactive bladder syndrome", "description": "A bladder disease characterized by urinary urgency without urinary tract infection or obvious pathology, usually accompanied by urinary frequency and nocturia." }, "synonyms": [ { "id": "DOID:0070355", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070355", "name": "OAB", "description": "" }, { "id": "DOID:0070355", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070355", "name": "overactive bladder", "description": "" }, { "id": "DOID:0070355", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070355", "name": "urge syndrome", "description": "" }, { "id": "DOID:0070355", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0070355", "name": "urgency-frequency syndrome", "description": "" } ], "evidence": [ { "id": "0070355", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0070355" } ] }, { "disease_id": "DOID:10247", "recommended_name": { "id": "DOID:10247", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10247", "name": "pleurisy", "description": "A pleural disease that is characterized by inflammation of the pleura, the lining of the pleural cavity surrounding the lungs." }, "synonyms": [], "evidence": [ { "id": "10247", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10247" } ] }, { "disease_id": "DOID:10763", "recommended_name": { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hypertension", "description": "An artery disease characterized by chronic elevated blood pressure in the arteries." }, "synonyms": [ { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "HTN", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hyperpiesia", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "vascular hypertensive disorder", "description": "" } ], "evidence": [ { "id": "10763", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10763" } ] }, { "disease_id": "DOID:11446", "recommended_name": { "id": "DOID:11446", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11446", "name": "sciatic neuropathy", "description": "" }, "synonyms": [], "evidence": [ { "id": "11446", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11446" } ] }, { "disease_id": "DOID:11713", "recommended_name": { "id": "DOID:11713", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11713", "name": "diabetic angiopathy", "description": "A peripheral vascular disease that is characterized by narrowing of the arteries as a complication arising from chronic diabetes." }, "synonyms": [ { "id": "DOID:11713", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11713", "name": "diabetic peripheral angiopathy", "description": "" }, { "id": "DOID:11713", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11713", "name": "Diabetic vascular disorder", "description": "" } ], "evidence": [ { "id": "11713", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:11713" } ] }, { "disease_id": "DOID:1826", "recommended_name": { "id": "DOID:1826", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1826", "name": "epilepsy", "description": "A brain disease that is characterized by the occurrance of at least two unprovoked seizures resulting from a persistent epileptogenic abnormality of the brain that is able to spontaneously generate paroxysmal activity and typically manifested by sudden brief episodes of altered or diminished consciousness, involuntary movements, or convulsions." }, "synonyms": [ { "id": "DOID:1826", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1826", "name": "epilepsy syndrome", "description": "" }, { "id": "DOID:1826", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1826", "name": "epileptic syndrome", "description": "" } ], "evidence": [ { "id": "1826", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1826" } ] }, { "disease_id": "DOID:2921", "recommended_name": { "id": "DOID:2921", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2921", "name": "glomerulonephritis", "description": "A nephritis that causes inflammation of the glomeruli located_in kidney." }, "synonyms": [], "evidence": [ { "id": "2921", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2921" } ] }, { "disease_id": "DOID:3770", "recommended_name": { "id": "DOID:3770", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3770", "name": "pulmonary fibrosis", "description": "An interstitial lung disease that is characterized by destruction, scarring, and thickening of the interstitial lung tissues and progressive pulmonary function loss in a restrictive pattern, has_symptom progressive shortness of breath, fatigue, and chronic cough, possibly has_material_basis_in exposure to certain chemicals, autoimmune conditions, and radiation." }, "synonyms": [ { "id": "DOID:3770", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3770", "name": "Fibrosis of lung", "description": "" } ], "evidence": [ { "id": "3770", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3770" } ] }, { "disease_id": "DOID:4483", "recommended_name": { "id": "DOID:4483", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4483", "name": "rhinitis", "description": "A upper respiratory infectious disease which involves irritation and inflammation of the mucous membrane of the nose due to viruses, bacteria or irritants. The inflammation results in generation of excessive amounts of mucus leading to runny nose, as well as nasal congestion and post-nasal drip." }, "synonyms": [], "evidence": [ { "id": "4483", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:4483" } ] }, { "disease_id": "DOID:5844", "recommended_name": { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "myocardial infarction", "description": "A coronary artery disease characterized by myocardial cell death (myocardial necrosis) due to prolonged ischaemia." }, "synonyms": [ { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "Myocardial infarct", "description": "" }, { "id": "DOID:5844", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5844", "name": "heart attack", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "myocardial infarction, susceptibility to, type 2", "description": "" }, { "id": "MONDO:0012058", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012058", "name": "Mci2", "description": "" } ], "evidence": [ { "id": "5844", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5844" } ] }, { "disease_id": "DOID:783", "recommended_name": { "id": "DOID:783", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:783", "name": "end stage renal disease", "description": "A chronic kidney disease is characterized by non-functioning kidneys, as the final stage in chronic kidney disease." }, "synonyms": [ { "id": "DOID:783", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:783", "name": "end stage renal failure", "description": "" }, { "id": "DOID:783", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:783", "name": "end-stage kidney disease", "description": "" } ], "evidence": [ { "id": "783", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:783" } ] }, { "disease_id": "DOID:8947", "recommended_name": { "id": "DOID:8947", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8947", "name": "diabetic retinopathy", "description": "" }, "synonyms": [ { "id": "DOID:8947", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8947", "name": "Retinal abnormality - diabetes-related", "description": "" } ], "evidence": [ { "id": "8947", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:8947" } ] }, { "disease_id": "DOID:9743", "recommended_name": { "id": "DOID:9743", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9743", "name": "diabetic neuropathy", "description": "" }, "synonyms": [], "evidence": [ { "id": "9743", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9743" } ] } ], "snv": [ { "evidence": [ { "id": "rs3389260682", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389260682" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 21, "end_pos": 21, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "12", "chr_pos": "105570498", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N21", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs3389260741", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389260741" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 22, "end_pos": 22, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (ITS->NTS).", "chr_id": "12", "chr_pos": "105570500", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I22", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q61125", "url": "https://www.uniprot.org/uniprot/Q61125" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Bdkrb1", "url": "https://www.uniprot.org/uniprot/Q61125", "locus": { "chromosome": "12", "start_pos": 105571687, "end_pos": 105569344, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000041347", "url": "https://www.ensembl.org/id/ENSMUSG00000041347" } ] } } ], "crossref": [ { "id": "ENSMUSG00000041347", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000041347", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd15380", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15380", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL1250407", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1250407", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "12061", "url": "https://www.ncbi.nlm.nih.gov/gene/12061", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000496", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000496", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001186", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001186", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:12061", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:12061", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "88144", "url": "http://www.informatics.jax.org/marker/MGI:88144", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "YLTFVHT", "url": "https://omabrowser.org/oma/group/YLTFVHT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4730030at2759", "url": "http://www.orthodb.org/?query=4730030at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10489", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10489", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10489:SF945", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10489:SF945", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00001", "url": "http://pfam.xfam.org/family/PF00001", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q61125", "url": "http://purl.obolibrary.org/obo/PR_Q61125", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-375276", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-416476", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418594", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_031565", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031565", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q61125", "url": "https://www.uniprot.org/uniprot/Q61125", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q61125-1", "url": "https://www.uniprot.org/uniprot/Q61125-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R1G8", "url": "https://www.uniprot.org/uniprot/S4R1G8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "S4R1G8-1", "url": "https://www.uniprot.org/uniprot/S4R1G8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASQASLKLQPSNQSQQAPPNITSCEGAPEAWDLLCRVLPGFVITVCFFGLLGNLLVLSFFLLPWRRWWQQRRQRLTIAEIYLANLAASDLVFVLGLPFWAENVGNRFNWPFGSDLCRVVSGVIKANLFISIFLVVAISQDRYRLLVYPMTSWGNRRRRQAQVTCLLIWVAGGLLSTPTFLLRSVKVVPDLNISACILLFPHEAWHFVRMVELNVLGFLLPLAAILYFNFHILASLRGQKEASRTRCGGPKDSKTMGLILTLVASFLVCWAPYHFFAFLDFLVQVRVIQDCFWKELTDLGLQLANFFAFVNSCLNPLIYVFAGRLFKTRVLGTL", "length": 334, "header": "sp|Q61125-1|BKRB1_MOUSE Isoform 1 of B1 bradykinin receptor OS=Mus musculus OX=10090 GN=Bdkrb1 PE=2 SV=1 CANONICAL=Q61125-1" }, "isoforms": [ { "isoform_ac": "Q61125-1", "url": "", "sequence": { "sequence": "MASQASLKLQPSNQSQQAPPNITSCEGAPEAWDLLCRVLPGFVITVCFFGLLGNLLVLSFFLLPWRRWWQQRRQRLTIAEIYLANLAASDLVFVLGLPFWAENVGNRFNWPFGSDLCRVVSGVIKANLFISIFLVVAISQDRYRLLVYPMTSWGNRRRRQAQVTCLLIWVAGGLLSTPTFLLRSVKVVPDLNISACILLFPHEAWHFVRMVELNVLGFLLPLAAILYFNFHILASLRGQKEASRTRCGGPKDSKTMGLILTLVASFLVCWAPYHFFAFLDFLVQVRVIQDCFWKELTDLGLQLANFFAFVNSCLNPLIYVFAGRLFKTRVLGTL", "length": 334, "header": "sp|Q61125-1|BKRB1_MOUSE Isoform 1 of B1 bradykinin receptor OS=Mus musculus OX=10090 GN=Bdkrb1 PE=2 SV=1 CANONICAL=Q61125-1" }, "locus": { "chromosome": "12", "start_pos": 105571437, "end_pos": 105570436, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000041229", "url": "https://www.ensembl.org/id/ENSMUST00000041229" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000045335", "url": "https://www.ensembl.org/id/ENSMUSP00000045335" } ] } }, { "isoform_ac": "S4R1G8-1", "url": "", "sequence": { "sequence": "MASQASLKLQPSNQSQQAPPNITSCEGAPEAWDLLCRVLPGFVITVCFFGLLGNLLVLSFFLLPWRRWWQQRRQRLTIAEIYLANLAASDLVFVLGLPFWAENVGNRFNWPFGSDLCRVVSGVIKANLFISIFLVVAISQDRYRLLVYPMTSWGNRRRRQAQVTCLLIWVAGGLLSTPTFLLRSVKVVPDLNISACILLFPHEAWHFVRMVELNVLGFLLPLAAILYFNFHILASLRGQKEASRTRCGGPKDSKTMGLILTLVASFLV", "length": 268, "header": "tr|S4R1G8-1|BKRB1_MOUSE Computationally mapped isoform of B1 bradykinin receptor OS=Mus musculus OX=10090 GN=Bdkrb1 PE=2 SV=1 CANONICAL=Q61125-1" }, "locus": { "chromosome": "12", "start_pos": 105571239, "end_pos": 105570436, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000183086.2", "url": "https://www.ensembl.org/id/ENSMUST00000183086.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000138216.2", "url": "https://www.ensembl.org/id/ENSMUSP00000138216.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 13, "start_aa": "Asn", "end_pos": 13, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn13", "evidence": [ { "id": "Q61125", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61125#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 192, "start_aa": "Asn", "end_pos": 192, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn192", "evidence": [ { "id": "Q61125", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61125#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 21, "start_aa": "Asn", "end_pos": 21, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn21", "evidence": [ { "id": "Q61125", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61125#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Bradykinin Receptors Play a Critical Role in the Chronic Post-ischaemia Pain Model.", "journal": "Cellular and molecular neurobiology", "date": "2021", "authors": "Goncalves ECD, Vieira G, Goncalves TR, Simoes RR, Brusco I, Oliveira SM, Calixto JB, Cola M, Santos ARS, Dutra RC", "evidence": [ { "database": "RefSeq", "id": "NP_031565", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031565" } ], "reference": [ { "type": "PubMed", "id": "32222846", "url": "https://glygen.org/publication/PubMed/32222846" } ] }, { "title": "Blockade of the kinin B1 receptor counteracts the depressive-like behaviour and mechanical allodynia in ovariectomised mice.", "journal": "Behavioural brain research", "date": "2021", "authors": "de Souza Maciel I, Azevedo VM, Oliboni P, Campos MM", "evidence": [ { "database": "RefSeq", "id": "NP_031565", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031565" } ], "reference": [ { "type": "PubMed", "id": "34197868", "url": "https://glygen.org/publication/PubMed/34197868" } ] }, { "title": "Hypothalamic kinin B1 receptor mediates orexin system hyperactivity in neurogenic hypertension.", "journal": "Scientific reports", "date": "2021", "authors": "Parekh RU, White A, Leffler KE, Biancardi VC, Eells JB, Abdel-Rahman AA, Sriramula S", "evidence": [ { "database": "RefSeq", "id": "NP_031565", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031565" } ], "reference": [ { "type": "PubMed", "id": "34702886", "url": "https://glygen.org/publication/PubMed/34702886" } ] }, { "title": "Kinin B1 receptor deficiency protects mice fed by cafeteria diet from abnormal glucose homeostasis.", "journal": "PloS one", "date": "2022", "authors": "Correia PE, Gomes CB, Bandeira VA, Marten T, Natividade GR, Merello P, Tozawa E, Cerski CTS, Budu A, Araujo R, Arbo BD, Ribeiro MFM, Barros CC, Gerchman F", "evidence": [ { "database": "RefSeq", "id": "NP_031565", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031565" } ], "reference": [ { "type": "PubMed", "id": "35617279", "url": "https://glygen.org/publication/PubMed/35617279" } ] }, { "title": "Molecular cloning and functional characterization of a mouse bradykinin B1 receptor gene.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1996", "authors": "Pesquero JB, Pesquero JL, Oliveira SM, Roscher AA, Metzger R, Ganten D, Bader M", "evidence": [ { "database": "UniProtKB", "id": "Q61125", "url": "https://www.uniprot.org/uniprot/Q61125" } ], "reference": [ { "type": "PubMed", "id": "8602848", "url": "https://glygen.org/publication/PubMed/8602848" } ] } ], "pathway": [ { "id": "mmu:12061", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:12061", "resource": "KEGG Pathway" }, { "id": "R-MMU-375276", "name": "Peptide ligand-binding receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-375276", "resource": "Reactome", "description": "Peptide ligand-binding receptors" }, { "id": "R-MMU-416476", "name": "G alpha (q) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-416476", "resource": "Reactome", "description": "G alpha (q) signalling events" }, { "id": "R-MMU-418594", "name": "G alpha (i) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418594", "resource": "Reactome", "description": "G alpha (i) signalling events" } ], "orthologs": [ { "uniprot_canonical_ac": "P46663-1", "protein_name": "B1 bradykinin receptor", "gene_name": "BDKRB1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLLVFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKANLFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQAVPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRCGGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFFAFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN", "length": 353 }, "evidence": [ { "id": "45225404", "url": "http://www.informatics.jax.org/homology/45225404", "database": "MGI" }, { "id": "Q61125", "url": "https://omabrowser.org/oma/group/Q61125/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P97583-1", "protein_name": "B1 bradykinin receptor", "gene_name": "Bdkrb1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASEVLLELQPSNRSLQAPANITSCESALEDWDLLYRVLPGFVITICFFGLLGNLLVLSFFLLPWRQWWWQQRQRQQRLTIAEIYLANLAASDLVFVLGLPFWAENIGNRFNWPFGTDLCRVVSGVIKANLFVSIFLVVAISQDRYRLLVYPMTSWGYRRRRQAQATCLLIWVAGGLLSIPTFLLRSVKVVPDLNVSACILLFPHEAWHFARMVELNVLGFLLPVTAIIFFNYHILASLRGQKEASRTRCGGPKGSKTTGLILTLVASFLVCWCPYHFFAFLDFLVQVRVIQDCSWKEITDLGLQLANFFAFVNSCLNPLIYVFAGRLLKTRVLGTL", "length": 337 }, "evidence": [ { "id": "45225404", "url": "http://www.informatics.jax.org/homology/45225404", "database": "MGI" }, { "id": "Q61125", "url": "https://omabrowser.org/oma/group/Q61125/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q61125", "url": "https://www.uniprot.org/uniprot/Q61125" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "Q61125", "url": "https://www.uniprot.org/uniprot/Q61125" } ], "pmid": "" }, { "name": "response to mechanical stimulus", "id": "GO:0009612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009612", "evidence": [ { "database": "UniProtKB", "id": "Q61125", "url": "https://www.uniprot.org/uniprot/Q61125" } ], "pmid": "" }, { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "Q61125", "url": "https://www.uniprot.org/uniprot/Q61125" } ], "pmid": "" }, { "name": "protein kinase C-activating G protein-coupled receptor signaling pathway", "id": "GO:0007205", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007205", "evidence": [ { "database": "UniProtKB", "id": "Q61125", "url": "https://www.uniprot.org/uniprot/Q61125" } ], "pmid": "" }, { "name": "cell migration", "id": "GO:0016477", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016477", "evidence": [ { "database": "UniProtKB", "id": "Q61125", "url": "https://www.uniprot.org/uniprot/Q61125" } ], "pmid": "" }, { "name": "response to lipopolysaccharide", "id": "GO:0032496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032496", "evidence": [ { "database": "UniProtKB", "id": "Q61125", "url": "https://www.uniprot.org/uniprot/Q61125" } ], "pmid": "" }, { "name": "negative regulation of protein phosphorylation", "id": "GO:0001933", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001933", "evidence": [ { "database": "UniProtKB", "id": "Q61125", "url": "https://www.uniprot.org/uniprot/Q61125" } ], "pmid": "" }, { "name": "negative regulation of blood pressure", "id": "GO:0045776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045776", "evidence": [ { "database": "UniProtKB", "id": "Q61125", "url": "https://www.uniprot.org/uniprot/Q61125" } ], "pmid": "" }, { "name": "negative regulation of cell growth", "id": "GO:0030308", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030308", "evidence": [ { "database": "UniProtKB", "id": "Q61125", "url": "https://www.uniprot.org/uniprot/Q61125" } ], "pmid": "" }, { "name": "positive regulation of release of sequestered calcium ion into cytosol", "id": "GO:0051281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051281", "evidence": [ { "database": "UniProtKB", "id": "Q61125", "url": "https://www.uniprot.org/uniprot/Q61125" } ], "pmid": "" }, { "name": "positive regulation of leukocyte migration", "id": "GO:0002687", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002687", "evidence": [ { "database": "UniProtKB", "id": "Q61125", "url": "https://www.uniprot.org/uniprot/Q61125" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "bradykinin receptor activity", "id": "GO:0004947", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004947", "evidence": [ { "database": "UniProtKB", "id": "Q61125", "url": "https://www.uniprot.org/uniprot/Q61125" } ], "pmid": "" }, { "name": "peptide binding", "id": "GO:0042277", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042277", "evidence": [ { "database": "UniProtKB", "id": "Q61125", "url": "https://www.uniprot.org/uniprot/Q61125" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 13, "end_pos": 15, "annotation": "n_glycosylation_sequon" }, { "start_pos": 192, "end_pos": 194, "annotation": "n_glycosylation_sequon" }, { "start_pos": 21, "end_pos": 23, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }