{ "uniprot_canonical_ac": "Q61080-1", "uniprot_ac": "Q61080", "uniprot_id": "FOXF1_MOUSE", "mass": { "chemical_mass": 39958.0, "monoisotopic_mass": 39958.0 }, "refseq": { "ac": "NP_034556", "name": "forkhead box protein F1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034556" }, "gene_names": [ { "name": "Foxf1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q61080", "id": "Q61080" }, { "name": "Fkhl5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q61080", "id": "Q61080" }, { "name": "Foxf1a; Freac-1; FREAC1; HFH-8; Hfh8", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034556", "id": "NP_034556" }, { "name": "Foxf1a", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q61080", "id": "Q61080" }, { "name": "Foxf1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034556", "id": "NP_034556" }, { "name": "Freac1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q61080", "id": "Q61080" }, { "name": "Hfh8", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q61080", "id": "Q61080" } ], "protein_names": [ { "name": "Forkhead box protein F1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q61080" }, { "name": "FREAC-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q61080" }, { "name": "Forkhead-related protein FKHL5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q61080" }, { "name": "Forkhead-related transcription factor 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q61080" }, { "name": "HFH-8", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q61080" }, { "name": "Hepatocyte nuclear factor 3 forkhead homolog 8", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q61080" }, { "name": "forkhead box protein F1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034556", "id": "NP_034556" }, { "name": "forkhead-related protein FKHL5; forkhead-related transcription factor 1; hepatocyte nuclear factor 3 forkhead homolog 8; HNF-3/forkhead homolog 8; forkhead box F1a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034556", "id": "NP_034556" } ], "function": [ { "annotation": "FOXF1 Regulates Alveolar Epithelial Morphogenesis through Transcriptional Activation of Mesenchymal WNT5A.", "evidence": [ { "database": "RefSeq", "id": "NP_034556", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034556" }, { "database": "PubMed", "id": "36542853", "url": "https://glygen.org/publication/PubMed/36542853" } ] }, { "annotation": "Probable transcription activator for a number of lung-specific genes.", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080#function" } ] }, { "annotation": "The transcription factors Foxf1 and Foxf2 integrate the SHH, HGF and TGFbeta signaling pathways to drive tongue organogenesis.", "evidence": [ { "database": "RefSeq", "id": "NP_034556", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034556" }, { "database": "PubMed", "id": "36227576", "url": "https://glygen.org/publication/PubMed/36227576" } ] } ], "disease": [ { "disease_id": "DOID:13042", "recommended_name": { "id": "DOID:13042", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13042", "name": "persistent fetal circulation syndrome", "description": "" }, "synonyms": [ { "id": "DOID:13042", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13042", "name": "Fetal circulation", "description": "" }, { "id": "DOID:13042", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13042", "name": "Persistent fetal circulation", "description": "" }, { "id": "DOID:13042", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13042", "name": "Persistent foetal circulation", "description": "" }, { "id": "DOID:13042", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13042", "name": "persistent foetal circulation syndrome", "description": "" }, { "id": "DOID:13042", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13042", "name": "persistent pulmonary hypertension of the newborn", "description": "" }, { "id": "DOID:13042", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:13042", "name": "congenital alveolar capillary dysplasia with misalignment of pulmonary veins", "description": "" }, { "id": "MONDO:0009934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009934", "name": "alveolar capillary dysplasia with misalignment of pulmonary veins", "description": "A rare and fatal developmental lung disease characterized by respiratory distress in neonates due to refractory hypoxemia and severe pulmonary arterial hypertension." }, { "id": "MONDO:0009934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009934", "name": "ACDMPV", "description": "" }, { "id": "MONDO:0009934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009934", "name": "alveolar capillary dysplasia", "description": "" }, { "id": "MONDO:0009934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009934", "name": "alveolar capillary dysplasia with misalignment of pulmonary veins", "description": "" }, { "id": "MONDO:0009934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009934", "name": "alveolar capillary dysplasia with misalignment of pulmonary vessels", "description": "" }, { "id": "MONDO:0009934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009934", "name": "congenital alveolar capillary dysplasia", "description": "" }, { "id": "MONDO:0009934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009934", "name": "congenital alveolar capillary dysplasia with misalignment of pulmonary veins", "description": "" }, { "id": "MONDO:0009934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009934", "name": "fetal circulation", "description": "" }, { "id": "MONDO:0009934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009934", "name": "foetal circulation", "description": "" }, { "id": "MONDO:0009934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009934", "name": "alveolar capillary dysplasia with misalignment of pulmonary veins and Other congenital anomalies", "description": "" }, { "id": "MONDO:0009934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009934", "name": "alveolar capillary dysplasia with misalignment of pulmonary veins and other congenital anomalies", "description": "" }, { "id": "MONDO:0009934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009934", "name": "alveolar capillary dysplasia with pulmonary venous misalignment", "description": "" }, { "id": "MONDO:0009934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009934", "name": "familial persistent pulmonary hypertension of the newborn", "description": "" }, { "id": "MONDO:0009934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009934", "name": "persistent fetal circulation", "description": "" }, { "id": "MONDO:0009934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009934", "name": "persistent foetal circulation", "description": "" }, { "id": "MONDO:0009934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009934", "name": "persistent foetal circulation syndrome", "description": "" }, { "id": "MONDO:0009934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009934", "name": "persistent pulmonary hypertension of the newborn", "description": "" }, { "id": "MONDO:0009934", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009934", "name": "pulmonary hypertension, familial persistent of the newborn", "description": "" }, { "id": "MIM:265380", "resource": "MIM", "url": "https://www.omim.org/entry/265380", "name": "Alveolar capillary dysplasia with misalignment of pulmonary veins", "description": "Alveolar capillary dysplasia with misalignment of pulmonary veins" } ], "evidence": [ { "id": "13042", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:13042" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Foxf1", "url": "https://www.uniprot.org/uniprot/Q61080", "locus": { "chromosome": "8", "start_pos": 121814883, "end_pos": 121811125, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000042812", "url": "https://www.ensembl.org/id/ENSMUSG00000042812" } ] } } ], "crossref": [ { "id": "ENSMUSG00000042812", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000042812", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd20049", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20049", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "15227", "url": "https://www.ncbi.nlm.nih.gov/gene/15227", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001766", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001766", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018122", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018122", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030456", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030456", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036388", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036388", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036390", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036390", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:15227", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:15227", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1347470", "url": "http://www.informatics.jax.org/marker/MGI:1347470", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "SGVMEPH", "url": "https://omabrowser.org/oma/group/SGVMEPH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5385885at2759", "url": "http://www.orthodb.org/?query=5385885at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46262", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46262", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46262:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46262:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00250", "url": "http://pfam.xfam.org/family/PF00250", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q61080", "url": "http://purl.obolibrary.org/obo/PR_Q61080", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_034556", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034556", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q61080-1", "url": "https://www.uniprot.org/uniprot/Q61080-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSAPDKQQPPHGGGTGGGGGAGGQAMDPAAAGPTKAKKTNAGVRRPEKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPVYSMVNGLGFNHLPDTYGFQGSGGLSCAPNSLALEGGLGMMNGHLAGNVDGMALPSHSVPHLPSNGGHSYMGGCGGSAAGEYPHHDSSVPASPLLPAGAGGVMEPHAVYSSSAAAWPPAASAALNSGASYIKQQPLSPCNPAANPLSGSISTHSLEQPYLHQNSHNGPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHTTGGGSYYHQQVTYQDIKPCVM", "length": 378, "header": "sp|Q61080-1|FOXF1_MOUSE Isoform 1 of Forkhead box protein F1 OS=Mus musculus OX=10090 GN=Foxf1 PE=2 SV=2 CANONICAL=Q61080-1" }, "isoforms": [ { "isoform_ac": "Q61080-1", "url": "", "sequence": { "sequence": "MSAPDKQQPPHGGGTGGGGGAGGQAMDPAAAGPTKAKKTNAGVRRPEKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPVYSMVNGLGFNHLPDTYGFQGSGGLSCAPNSLALEGGLGMMNGHLAGNVDGMALPSHSVPHLPSNGGHSYMGGCGGSAAGEYPHHDSSVPASPLLPAGAGGVMEPHAVYSSSAAAWPPAASAALNSGASYIKQQPLSPCNPAANPLSGSISTHSLEQPYLHQNSHNGPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHTTGGGSYYHQQVTYQDIKPCVM", "length": 378, "header": "sp|Q61080-1|FOXF1_MOUSE Isoform 1 of Forkhead box protein F1 OS=Mus musculus OX=10090 GN=Foxf1 PE=2 SV=2 CANONICAL=Q61080-1" }, "locus": { "chromosome": "8", "start_pos": 121813615, "end_pos": 121811138, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000181504", "url": "https://www.ensembl.org/id/ENSMUST00000181504" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000137662", "url": "https://www.ensembl.org/id/ENSMUSP00000137662" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Structural characterization of the mouse Foxf1a gene.", "journal": "Gene", "date": "2001", "authors": "Ho Y.S., Chang V.W.H.", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "reference": [ { "type": "PubMed", "id": "11313147", "url": "https://glygen.org/publication/PubMed/11313147" } ] }, { "title": "The transcription factors Foxf1 and Foxf2 integrate the SHH, HGF and TGF\u03b2 signaling pathways to drive tongue organogenesis.", "journal": "Development (Cambridge, England)", "date": "2022-11-01", "authors": "Xu Jingyue, Liu Han, Lan Yu, Jiang Rulang", "evidence": [ { "database": "RefSeq", "id": "NP_034556", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034556" } ], "reference": [ { "type": "PubMed", "id": "36227576", "url": "https://glygen.org/publication/PubMed/36227576" } ] }, { "title": "FOXF1 Regulates Alveolar Epithelial Morphogenesis Through Transcriptional Activation of Mesenchymal WNT5A.", "journal": "American journal of respiratory cell and molecular biology", "date": "2022-12-21", "authors": "Reza Abid A, Kohram Fatemeh, Reza Hasan A, Kalin Timothy R, Kannan Paranthaman S, Zacharias William J, Kalinichenko Vladimir V", "evidence": [ { "database": "RefSeq", "id": "NP_034556", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034556" } ], "reference": [ { "type": "PubMed", "id": "36542853", "url": "https://glygen.org/publication/PubMed/36542853" } ] }, { "title": "Members of the HNF-3/forkhead family of transcription factors exhibit distinct cellular expression patterns in lung and regulate the surfactant protein B promoter.", "journal": "Dev. Biol.", "date": "1994", "authors": "Ye H., Costa R.H., Clevidence D.E., Overdier D.G., Peterson R.S., Paulson K.E., Porcella A.", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "reference": [ { "type": "PubMed", "id": "7958446", "url": "https://glygen.org/publication/PubMed/7958446" } ] }, { "title": "Differential activation of lung-specific genes by two forkhead proteins, FREAC-1 and FREAC-2.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Hellqvist M, Mahlapuu M, Samuelsson L, Enerback S, Carlsson P", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "reference": [ { "type": "PubMed", "id": "8626802", "url": "https://glygen.org/publication/PubMed/8626802" } ] } ], "pathway": [ { "id": "mmu:15227", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:15227", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q12946-1", "protein_name": "Forkhead box protein F1", "gene_name": "FOXF1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSSAPEKQQPPHGGGGGGGGGGGAAMDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYSMMNGLGFNHLPDTYGFQGSAGGLSCPPNSLALEGGLGMMNGHLPGNVDGMALPSHSVPHLPSNGGHSYMGGCGGAAAGEYPHHDSSVPASPLLPTGAGGVMEPHAVYSGSAAAWPPSASAALNSGASYIKQQPLSPCNPAANPLSGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHSAGGGSYYHQQVTYQDIKPCVM", "length": 379 }, "evidence": [ { "id": "45233681", "url": "http://www.informatics.jax.org/homology/45233681", "database": "MGI" }, { "id": "Q61080", "url": "https://omabrowser.org/oma/group/Q61080/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 51, "go_terms": [ { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "vasculogenesis", "id": "GO:0001570", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001570", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "in utero embryonic development", "id": "GO:0001701", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001701", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "heart development", "id": "GO:0007507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007507", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "extracellular matrix organization", "id": "GO:0030198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030198", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "positive regulation of cell migration", "id": "GO:0030335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "establishment of epithelial cell apical/basal polarity", "id": "GO:0045198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045198", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "lung alveolus development", "id": "GO:0048286", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048286", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "lung development", "id": "GO:0030324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030324", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "negative regulation of inflammatory response", "id": "GO:0050728", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050728", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "cell-cell adhesion", "id": "GO:0098609", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098609", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "embryonic digestive tract development", "id": "GO:0048566", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048566", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "mesenchyme migration", "id": "GO:0090131", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090131", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "blood vessel development", "id": "GO:0001568", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001568", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "midgut development", "id": "GO:0007494", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007494", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "animal organ morphogenesis", "id": "GO:0009887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009887", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "positive regulation of cell-substrate adhesion", "id": "GO:0010811", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010811", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "pancreas development", "id": "GO:0031016", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031016", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "somitogenesis", "id": "GO:0001756", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001756", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "venous blood vessel development", "id": "GO:0060841", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060841", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "determination of left/right symmetry", "id": "GO:0007368", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007368", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "smooth muscle cell differentiation", "id": "GO:0051145", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051145", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "cellular response to cytokine stimulus", "id": "GO:0071345", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071345", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "digestive tract development", "id": "GO:0048565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048565", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "cellular response to organic cyclic compound", "id": "GO:0071407", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071407", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "smoothened signaling pathway", "id": "GO:0007224", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007224", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "ductus arteriosus closure", "id": "GO:0097070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097070", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "morphogenesis of a branching structure", "id": "GO:0001763", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001763", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "lung vasculature development", "id": "GO:0060426", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060426", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "detection of wounding", "id": "GO:0014822", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014822", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "respiratory tube development", "id": "GO:0030323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030323", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "lateral mesodermal cell differentiation", "id": "GO:0048371", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048371", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "embryonic ectodermal digestive tract morphogenesis", "id": "GO:0048613", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048613", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "right lung morphogenesis", "id": "GO:0060461", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060461", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "ureter development", "id": "GO:0072189", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072189", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "mesoderm development", "id": "GO:0007498", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007498", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "embryonic foregut morphogenesis", "id": "GO:0048617", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048617", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "positive regulation of mesenchymal cell proliferation", "id": "GO:0002053", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002053", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "endocardial cushion development", "id": "GO:0003197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003197", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "lung morphogenesis", "id": "GO:0060425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060425", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "trachea development", "id": "GO:0060438", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060438", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "epithelial tube branching involved in lung morphogenesis", "id": "GO:0060441", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060441", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "cardiac left ventricle morphogenesis", "id": "GO:0003214", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003214", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "negative regulation of mast cell degranulation", "id": "GO:0043305", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043305", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "mesodermal cell differentiation", "id": "GO:0048333", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048333", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "embryonic digestive tract morphogenesis", "id": "GO:0048557", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048557", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "lung lobe morphogenesis", "id": "GO:0060463", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060463", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "epithelial cell differentiation involved in mammary gland alveolus development", "id": "GO:0061030", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061030", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "RNA polymerase II transcription regulatory region sequence-specific DNA binding", "id": "GO:0000977", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000977", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "transcription cis-regulatory region binding", "id": "GO:0000976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000976", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q61080", "url": "https://www.uniprot.org/uniprot/Q61080" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 99, "end_pos": 101, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }