{
    "uniprot_canonical_ac": "Q60931-1",
    "uniprot_ac": "Q60931",
    "uniprot_id": "VDAC3_MOUSE",
    "mass": {
        "chemical_mass": 30753.0,
        "monoisotopic_mass": 30753.0
    },
    "refseq": {
        "ac": "NP_035826",
        "name": "voltage-dependent anion-selective channel protein 3 isoform 2",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035826"
    },
    "gene_names": [
        {
            "name": "Vdac3",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q60931",
            "id": "Q60931"
        },
        {
            "name": "Vdac3",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035826",
            "id": "NP_035826"
        }
    ],
    "protein_names": [
        {
            "name": "Voltage-dependent anion-selective channel protein 3",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q60931"
        },
        {
            "name": "Outer mitochondrial membrane protein porin 3",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q60931"
        },
        {
            "name": "VDAC-3",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q60931"
        },
        {
            "name": "mVDAC3",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q60931"
        },
        {
            "name": "voltage-dependent anion-selective channel protein 3 isoform 2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035826",
            "id": "NP_035826"
        },
        {
            "name": "voltage-dependent anion-selective channel protein 3; channel protein VDAC3; mitochondrial outer membrane protein; VDAC-3; mVDAC3; outer mitochondrial membrane protein porin 3",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035826",
            "id": "NP_035826"
        }
    ],
    "function": [
        {
            "annotation": "Abnormal regulation of VDACs negatively affected sperm function. Thus, VDACs may be key regulators of the fertilization ability of spermatozoa.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_035826",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035826"
                },
                {
                    "database": "PubMed",
                    "id": "23062735",
                    "url": "https://glygen.org/publication/PubMed/23062735"
                }
            ]
        },
        {
            "annotation": "Bcl-xL interacts functionally with VDAC1 and -3 but not VDAC2.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_035826",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035826"
                },
                {
                    "database": "PubMed",
                    "id": "23720737",
                    "url": "https://glygen.org/publication/PubMed/23720737"
                }
            ]
        },
        {
            "annotation": "Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules (By similarity). Involved in male fertility and sperm mitochondrial sheath formation (PubMed:35228556).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q60931",
                    "url": "https://www.uniprot.org/uniprot/Q60931#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "P21796",
                    "url": "https://www.uniprot.org/uniprot/P21796#function"
                },
                {
                    "database": "PubMed",
                    "id": "35228556",
                    "url": "https://glygen.org/publication/PubMed/35228556"
                }
            ]
        },
        {
            "annotation": "Results suggest that knocking out mitochondrial VDAC3 increases ROS, alters renal sodium transport, and leads to hypertension.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_035826",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035826"
                },
                {
                    "database": "PubMed",
                    "id": "29180450",
                    "url": "https://glygen.org/publication/PubMed/29180450"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:8466",
            "recommended_name": {
                "id": "DOID:8466",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:8466",
                "name": "retinal degeneration",
                "description": "A retinal disease that is characterized by deterioration of the retina caused by the progressive and eventual death of the cells of the retina."
            },
            "synonyms": [
                {
                    "id": "DOID:8466",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:8466",
                    "name": "degeneration of retina",
                    "description": ""
                }
            ],
            "evidence": [
                {
                    "id": "8466",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:8466"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q60931",
                    "url": "https://www.uniprot.org/uniprot/Q60931"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Vdac3",
            "url": "https://www.uniprot.org/uniprot/Q60931",
            "locus": {
                "chromosome": "8",
                "start_pos": 23067091,
                "end_pos": 23083829,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000008892",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000008892"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000008892",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000008892",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "cd07306",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07306",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "22335",
            "url": "https://www.ncbi.nlm.nih.gov/gene/22335",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "J3QMG3",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:J3QMG3*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "Q60931",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:Q60931*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR001925",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001925",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR023614",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR023614",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR027246",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR027246",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:22335",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:22335",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "106922",
            "url": "http://www.informatics.jax.org/marker/MGI:106922",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "Q60931",
            "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q60931",
            "database": "O-GlcNAc Database",
            "categories": [
                "Glycoproteomics"
            ]
        },
        {
            "id": "ITLTEKW",
            "url": "https://omabrowser.org/oma/group/ITLTEKW/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "2897965at2759",
            "url": "http://www.orthodb.org/?query=2897965at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11743",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11743",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11743:SF28",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11743:SF28",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF01459",
            "url": "http://pfam.xfam.org/family/PF01459",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q60931",
            "url": "http://purl.obolibrary.org/obo/PR_Q60931",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-MMU-5689880",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5689880",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_035826",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035826",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "J3QMG3",
            "url": "https://www.uniprot.org/uniprot/J3QMG3",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "J3QMG3-1",
            "url": "https://www.uniprot.org/uniprot/J3QMG3-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q60931",
            "url": "https://www.uniprot.org/uniprot/Q60931",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q60931-1",
            "url": "https://www.uniprot.org/uniprot/Q60931-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYRRDCFSLGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTHVNDGTEFGGSIYQKVNERIETSINLAWTAGSNNTRFGIAAKYKLDCRTSLSAKVNNASLIGLGYTQTLRPGVKLTLSALIDGKNFNAGGHKVGLGFELEA",
        "length": 283,
        "header": "sp|Q60931-1|VDAC3_MOUSE Isoform 1 of Voltage-dependent anion-selective channel protein 3  OS=Mus musculus OX=10090 GN=Vdac3 PE=1 SV=1 CANONICAL=Q60931-1"
    },
    "isoforms": [
        {
            "isoform_ac": "J3QMG3-1",
            "url": "",
            "sequence": {
                "sequence": "MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYRRDCFSLGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTHVNDGTEFGGSIYQKVNERIETSINLAWTAGSNNTRFGIAAKYKLDCRTSLSAKVNNASLIGLGYTQTLRPGVKLTLSALIDGKNFNAGGHKVGLGFELEA",
                "length": 284,
                "header": "tr|J3QMG3-1|VDAC3_MOUSE Computationally mapped isoform of Voltage-dependent anion-selective channel protein 3  OS=Mus musculus OX=10090 GN=Vdac3 PE=1 SV=1 CANONICAL=Q60931-1"
            },
            "locus": {
                "chromosome": "8",
                "start_pos": 23078808,
                "end_pos": 23067530,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000179233.2",
                        "url": "https://www.ensembl.org/id/ENSMUST00000179233.2"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000136273.2",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000136273.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q60931-1",
            "url": "",
            "sequence": {
                "sequence": "MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYRRDCFSLGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTHVNDGTEFGGSIYQKVNERIETSINLAWTAGSNNTRFGIAAKYKLDCRTSLSAKVNNASLIGLGYTQTLRPGVKLTLSALIDGKNFNAGGHKVGLGFELEA",
                "length": 283,
                "header": "sp|Q60931-1|VDAC3_MOUSE Isoform 1 of Voltage-dependent anion-selective channel protein 3  OS=Mus musculus OX=10090 GN=Vdac3 PE=1 SV=1 CANONICAL=Q60931-1"
            },
            "locus": {
                "chromosome": "8",
                "start_pos": 23078808,
                "end_pos": 23067530,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000009036",
                        "url": "https://www.ensembl.org/id/ENSMUST00000009036"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000009036",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000009036"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "G49108TO",
            "type": "O-linked",
            "subtype": "O-GlcNAcylation",
            "site_category": "reported_with_glycan",
            "site_seq": "",
            "relation": "attached",
            "comment": "O-GlcNAcylation",
            "evidence": [
                {
                    "id": "Q60931",
                    "database": "O-GlcNAc Database",
                    "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q60931"
                },
                {
                    "id": "33300544",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/33300544"
                },
                {
                    "id": "22645316",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/22645316"
                },
                {
                    "id": "24788674",
                    "database": "PubMed",
                    "url": "https://glygen.org/publication/PubMed/24788674"
                }
            ]
        }
    ],
    "phosphorylation": [
        {
            "start_pos": 241,
            "end_pos": 241,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q60931",
                    "url": "https://www.uniprot.org/uniprot/Q60931"
                }
            ],
            "site_lbl": "Ser241"
        },
        {
            "start_pos": 4,
            "end_pos": 4,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Thr",
            "comment": "Phosphothreonine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q60931",
                    "url": "https://www.uniprot.org/uniprot/Q60931"
                }
            ],
            "site_lbl": "Thr4"
        }
    ],
    "glycation": [],
    "keywords": [
        "glycoprotein",
        "glycoprotein_reported_with_glycan"
    ],
    "publication": [
        {
            "title": "Global identification and characterization of both O-GlcNAcylation and phosphorylation at the murine synapse.",
            "journal": "Molecular & cellular proteomics : MCP",
            "date": "2012",
            "authors": "Trinidad JC, Barkan DT, Gulledge BF, Thalhammer A, Sali A, Schoepfer R, Burlingame AL",
            "evidence": [
                {
                    "database": "O-GlcNAc Database",
                    "id": "Q60931",
                    "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q60931"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22645316",
                    "url": "https://glygen.org/publication/PubMed/22645316"
                }
            ]
        },
        {
            "title": "Voltage-dependent anion channels are a key factor of male fertility.",
            "journal": "Fertility and sterility",
            "date": "2013",
            "authors": "Kwon WS, Park YJ, Mohamed el-SA, Pang MG",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_035826",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035826"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23062735",
                    "url": "https://glygen.org/publication/PubMed/23062735"
                }
            ]
        },
        {
            "title": "Label-free quantitative proteomics of the lysine acetylome in mitochondria identifies substrates of SIRT3 in metabolic pathways.",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "2013",
            "authors": "Rardin MJ, Newman JC, Held JM, Cusack MP, Sorensen DJ, Li B, Schilling B, Mooney SD, Kahn CR, Verdin E, Gibson BW",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "J3QMG3",
                    "url": "https://www.uniprot.org/uniprot/J3QMG3"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q60931",
                    "url": "https://www.uniprot.org/uniprot/Q60931"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23576753",
                    "url": "https://glygen.org/publication/PubMed/23576753"
                }
            ]
        },
        {
            "title": "An interaction between Bcl-xL and the voltage-dependent anion channel (VDAC) promotes mitochondrial Ca2+ uptake.",
            "journal": "The Journal of biological chemistry",
            "date": "2013",
            "authors": "Huang H, Hu X, Eno CO, Zhao G, Li C, White C",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_035826",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035826"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23720737",
                    "url": "https://glygen.org/publication/PubMed/23720737"
                }
            ]
        },
        {
            "title": "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.",
            "journal": "Mol. Cell",
            "date": "2013",
            "authors": "Park J, Chen Y, Tishkoff DX, Peng C, Tan M, Dai L, Xie Z, Zhang Y, Zwaans BM, Skinner ME, Lombard DB, Zhao Y",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "J3QMG3",
                    "url": "https://www.uniprot.org/uniprot/J3QMG3"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q60931",
                    "url": "https://www.uniprot.org/uniprot/Q60931"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "23806337",
                    "url": "https://glygen.org/publication/PubMed/23806337"
                }
            ]
        },
        {
            "title": "Identification of O-GlcNAc modification targets in mouse retinal pericytes: implication of p53 in pathogenesis of diabetic retinopathy.",
            "journal": "PloS one",
            "date": "2014",
            "authors": "Gurel Z, Zaro BW, Pratt MR, Sheibani N",
            "evidence": [
                {
                    "database": "O-GlcNAc Database",
                    "id": "Q60931",
                    "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q60931"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24788674",
                    "url": "https://glygen.org/publication/PubMed/24788674"
                }
            ]
        },
        {
            "title": "Knockout of mitochondrial voltage-dependent anion channel type 3 increases reactive oxygen species (ROS) levels and alters renal sodium transport.",
            "journal": "The Journal of biological chemistry",
            "date": "2018",
            "authors": "Zou L, Linck V, Zhai YJ, Galarza-Paez L, Li L, Yue Q, Al-Khalili O, Bao HF, Ma HP, Thai TL, Jiao J, Eaton DC",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_035826",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035826"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29180450",
                    "url": "https://glygen.org/publication/PubMed/29180450"
                }
            ]
        },
        {
            "title": "O-GlcNAcylation regulates dopamine neuron function, survival and degeneration in Parkinson disease.",
            "journal": "Brain : a journal of neurology",
            "date": "2020",
            "authors": "Lee BE, Kim HY, Kim HJ, Jeong H, Kim BG, Lee HE, Lee J, Kim HB, Lee SE, Yang YR, Yi EC, Hanover JA, Myung K, Suh PG, Kwon T, Kim JI",
            "evidence": [
                {
                    "database": "O-GlcNAc Database",
                    "id": "Q60931",
                    "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q60931"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "33300544",
                    "url": "https://glygen.org/publication/PubMed/33300544"
                }
            ]
        },
        {
            "title": "Kastor and Polluks polypeptides encoded by a single gene locus cooperatively regulate VDAC and spermatogenesis.",
            "journal": "Nat. Commun.",
            "date": "2022",
            "authors": "Shimizu H., Suyama M., Takahashi M., Yasuda T., Matsumoto A., Saito D., Ikawa M., Hosaka T., Shirouzu M., Izumi Y., Ide T., Shimada K., Nakayama K.I., Miyata H., Bamba T., Kimura-Someya T., Ichihara K., Mise S., Shiraishi C.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q60931",
                    "url": "https://www.uniprot.org/uniprot/Q60931"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "35228556",
                    "url": "https://glygen.org/publication/PubMed/35228556"
                }
            ]
        },
        {
            "title": "A novel mouse mitochondrial voltage-dependent anion channel gene localizes to chromosome 8.",
            "journal": "Genomics",
            "date": "1996",
            "authors": "Craigen W.J., Lovell R.S., Sampson M.J., Davison D.B.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q60931",
                    "url": "https://www.uniprot.org/uniprot/Q60931"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "8812436",
                    "url": "https://glygen.org/publication/PubMed/8812436"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:22335",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:22335",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-MMU-5689880",
            "name": "Ub-specific processing proteases",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5689880",
            "resource": "Reactome",
            "description": "Ub-specific processing proteases"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "P04840-1",
            "protein_name": "Mitochondrial outer membrane protein porin 1",
            "gene_name": "POR1",
            "tax_id": 559292,
            "organism": "Saccharomyces cerevisiae S288C",
            "sequence": {
                "sequence": "MSPPVYSDISRNINDLLNKDFYHATPAAFDVQTTTANGIKFSLKAKQPVKDGPLSTNVEAKLNDKQTGLGLTQGWSNTNNLQTKLEFANLTPGLKNELITSLTPGVAKSAVLNTTFTQPFFTARGAFDLCLKSPTFVGDLTMAHEGIVGGAEFGYDISAGSISRYAMALSYFAKDYSLGATLNNEQITTVDFFQNVNAFLQVGAKATMNCKLPNSNVNIEFATRYLPDASSQVKAKVSDSGIVTLAYKQLLRPGVTLGVGSSFDALKLSEPVHKLGWSLSFDA",
                "length": 283
            },
            "evidence": [
                {
                    "id": "Q60931",
                    "url": "https://omabrowser.org/oma/group/Q60931/",
                    "database": "OMA"
                }
            ],
            "common_name": "Yeast"
        },
        {
            "uniprot_canonical_ac": "Q94920-1",
            "protein_name": "Voltage-dependent anion-selective channel",
            "gene_name": "porin",
            "tax_id": 7227,
            "organism": "Drosophila melanogaster",
            "sequence": {
                "sequence": "MAPPSYSDLGKQARDIFSKGYNFGLWKLDLKTKTSSGIEFNTAGHSNQESGKVFGSLETKYKVKDYGLTLTEKWNTDNTLFTEVAVQDQLLEGLKLSLEGNFAPQSGNKNGKFKVAYGHENVKADSDVNIDLKGPLINASAVLGYQGWLAGYQTAFDTQQSKLTTNNFALGYTTKDFVLHTAVNDGQEFSGSIFQRTSDKLDVGVQLSWASGTSNTKFAIGAKYQLDDDASVRAKVNNASQVGLGYQQKLRDGVTLTLSTLVDGKNFNAGGHKIGVGLELEA",
                "length": 282
            },
            "evidence": [
                {
                    "id": "Q60931",
                    "url": "https://omabrowser.org/oma/group/Q60931/",
                    "database": "OMA"
                }
            ],
            "common_name": "Fruit fly"
        },
        {
            "uniprot_canonical_ac": "Q9R1Z0-1",
            "protein_name": "Voltage-dependent anion-selective channel protein 3",
            "gene_name": "Vdac3",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MCSTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLIFTQKWNTDNTLGTEISWENKLAEGLKLTVDTIFVPNTGKKSGKLKASYRRDCFSVGSKVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLCQNNFALGYKAEDFQLHTHVNDGTEFGGSIYQRVNEKIETSINLAWTAGSNNTRFGIAAKYRLDCRTSLSAKVNNASLIGLGYTQSLRPGVKLTLSALVDGKNFNAGGHKVGLGFELEA",
                "length": 283
            },
            "evidence": [
                {
                    "id": "45232441",
                    "url": "http://www.informatics.jax.org/homology/45232441",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        },
        {
            "uniprot_canonical_ac": "Q9Y277-1",
            "protein_name": "Voltage-dependent anion-selective channel protein 3",
            "gene_name": "VDAC3",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTHVNDGTEFGGSIYQKVNEKIETSINLAWTAGSNNTRFGIAAKYMLDCRTSLSAKVNNASLIGLGYTQTLRPGVKLTLSALIDGKNFSAGGHKVGLGFELEA",
                "length": 283
            },
            "evidence": [
                {
                    "id": "45232441",
                    "url": "http://www.informatics.jax.org/homology/45232441",
                    "database": "MGI"
                },
                {
                    "id": "Q60931",
                    "url": "https://omabrowser.org/oma/group/Q60931/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 6,
                "go_terms": [
                    {
                        "name": "mitochondrion",
                        "id": "GO:0005739",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q60931",
                                "url": "https://www.uniprot.org/uniprot/Q60931"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "mitochondrial outer membrane",
                        "id": "GO:0005741",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005741",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q60931",
                                "url": "https://www.uniprot.org/uniprot/Q60931"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "mitochondrial inner membrane",
                        "id": "GO:0005743",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q60931",
                                "url": "https://www.uniprot.org/uniprot/Q60931"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "membrane",
                        "id": "GO:0016020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q60931",
                                "url": "https://www.uniprot.org/uniprot/Q60931"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "synaptic vesicle",
                        "id": "GO:0008021",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008021",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q60931",
                                "url": "https://www.uniprot.org/uniprot/Q60931"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "pore complex",
                        "id": "GO:0046930",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046930",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q60931",
                                "url": "https://www.uniprot.org/uniprot/Q60931"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 6,
                "go_terms": [
                    {
                        "name": "spermatogenesis",
                        "id": "GO:0007283",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q60931",
                                "url": "https://www.uniprot.org/uniprot/Q60931"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "learning",
                        "id": "GO:0007612",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007612",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q60931",
                                "url": "https://www.uniprot.org/uniprot/Q60931"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "chemical synaptic transmission",
                        "id": "GO:0007268",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007268",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q60931",
                                "url": "https://www.uniprot.org/uniprot/Q60931"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "behavioral fear response",
                        "id": "GO:0001662",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001662",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q60931",
                                "url": "https://www.uniprot.org/uniprot/Q60931"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "neuron-neuron synaptic transmission",
                        "id": "GO:0007270",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007270",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q60931",
                                "url": "https://www.uniprot.org/uniprot/Q60931"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "sperm mitochondrial sheath assembly",
                        "id": "GO:0120317",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120317",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q60931",
                                "url": "https://www.uniprot.org/uniprot/Q60931"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 3,
                "go_terms": [
                    {
                        "name": "nucleotide binding",
                        "id": "GO:0000166",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000166",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q60931",
                                "url": "https://www.uniprot.org/uniprot/Q60931"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "porin activity",
                        "id": "GO:0015288",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015288",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q60931",
                                "url": "https://www.uniprot.org/uniprot/Q60931"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "voltage-gated monoatomic anion channel activity",
                        "id": "GO:0008308",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008308",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q60931",
                                "url": "https://www.uniprot.org/uniprot/Q60931"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 215,
            "end_pos": 217,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 239,
            "end_pos": 241,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [
        {
            "annotation": "Ubiquitinated by PRKN during mitophagy, leading to its degradation and enhancement of mitophagy. Deubiquitinated by USP30.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q60931",
                    "url": "https://www.uniprot.org/uniprot/Q60931"
                },
                {
                    "database": "PubMed",
                    "id": "Q9Y277",
                    "url": "https://glygen.org/publication/PubMed/Q9Y277"
                }
            ]
        }
    ],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 1
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 1
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment"
            ]
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                },
                {
                    "field": "total_sites",
                    "count": 2
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 10
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}