{ "uniprot_canonical_ac": "Q60882-1", "uniprot_ac": "Q60882", "uniprot_id": "OR8B8_MOUSE", "mass": { "chemical_mass": 34451.0, "monoisotopic_mass": 34451.0 }, "refseq": { "ac": "NP_666425", "name": "olfactory receptor 8B8", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666425" }, "gene_names": [ { "name": "Or8b8", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q60882", "id": "Q60882" }, { "name": "K21; MOR161-6; Olfr145", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666425", "id": "NP_666425" }, { "name": "Mor161-6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q60882", "id": "Q60882" }, { "name": "Olfr145", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q60882", "id": "Q60882" }, { "name": "Olfr7", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q60882", "id": "Q60882" }, { "name": "Or8b8", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666425", "id": "NP_666425" } ], "protein_names": [ { "name": "Olfactory receptor 8B8", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q60882" }, { "name": "Odorant receptor K21", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q60882" }, { "name": "Olfactory receptor 145", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q60882" }, { "name": "Olfactory receptor 161-6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q60882" }, { "name": "Olfactory receptor 7C", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q60882" }, { "name": "olfactory receptor 8B8", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666425", "id": "NP_666425" }, { "name": "olfactory receptor MOR161-6; odorant receptor K21; olfactory receptor 7C; olfactory receptor 161-6; GA_x6K02T2PVTD-31578734-31579666; olfactory receptor 145", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666425", "id": "NP_666425" } ], "function": [ { "annotation": "Odorant receptor.", "evidence": [ { "database": "UniProtKB", "id": "Q60882", "url": "https://www.uniprot.org/uniprot/Q60882#function" } ] }, { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_666425", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666425" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q60882", "url": "https://www.uniprot.org/uniprot/Q60882" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Or8b8", "url": "https://www.uniprot.org/uniprot/Q60882", "locus": { "chromosome": "9", "start_pos": 37814815, "end_pos": 37808020, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000066748", "url": "https://www.ensembl.org/id/ENSMUSG00000066748" } ] } } ], "crossref": [ { "id": "ENSMUSG00000066748", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000066748", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd15405", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15405", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "258310", "url": "https://www.ncbi.nlm.nih.gov/gene/258310", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:258310", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:258310", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2177528", "url": "http://www.informatics.jax.org/marker/MGI:2177528", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "CNPLVYM", "url": "https://omabrowser.org/oma/group/CNPLVYM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5401587at2759", "url": "http://www.orthodb.org/?query=5401587at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR48018", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48018:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "http://pfam.xfam.org/family/PF13853", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q60882", "url": "http://purl.obolibrary.org/obo/PR_Q60882", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_666425", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666425", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q60882", "url": "https://www.uniprot.org/uniprot/Q60882", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q60882-1", "url": "https://www.uniprot.org/uniprot/Q60882-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MATENASVPEFILAGLTDQPGLRMPLFFLFLGFYMVTMVGNLGLITLIGLNSHLHTPMYFFLFNLSLIDFCYSTVITPKMLVSFVSKKNIISYSGCMTQLFFFLFFVVSESFILSAMAYDRYVAICNPLMYTVTMSPQVCLLLLLGVYVMGFAGAMAHTAFMVKLTFCADKLVNHYMCDILPLLERSCTSTYVNELVVFIVVGIDIGVPTVTIFISYALILSSILRISSTEGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPSSLLPMNQGKVSSLFYTIVVPMLNPLIYSLRNKDVKVALRKTLSRSSFS", "length": 310, "header": "sp|Q60882-1|OR8B8_MOUSE Isoform 1 of Olfactory receptor 8B8 OS=Mus musculus OX=10090 GN=Or8b8 PE=3 SV=2 CANONICAL=Q60882-1" }, "isoforms": [ { "isoform_ac": "Q60882-1", "url": "", "sequence": { "sequence": "MATENASVPEFILAGLTDQPGLRMPLFFLFLGFYMVTMVGNLGLITLIGLNSHLHTPMYFFLFNLSLIDFCYSTVITPKMLVSFVSKKNIISYSGCMTQLFFFLFFVVSESFILSAMAYDRYVAICNPLMYTVTMSPQVCLLLLLGVYVMGFAGAMAHTAFMVKLTFCADKLVNHYMCDILPLLERSCTSTYVNELVVFIVVGIDIGVPTVTIFISYALILSSILRISSTEGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPSSLLPMNQGKVSSLFYTIVVPMLNPLIYSLRNKDVKVALRKTLSRSSFS", "length": 310, "header": "sp|Q60882-1|OR8B8_MOUSE Isoform 1 of Olfactory receptor 8B8 OS=Mus musculus OX=10090 GN=Or8b8 PE=3 SV=2 CANONICAL=Q60882-1" }, "locus": { "chromosome": "9", "start_pos": 37809631, "end_pos": 37808702, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000086062", "url": "https://www.ensembl.org/id/ENSMUST00000086062" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000083229", "url": "https://www.ensembl.org/id/ENSMUSP00000083229" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 5, "start_aa": "Asn", "end_pos": 5, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn5", "evidence": [ { "id": "Q60882", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60882#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Characterization of a cluster comprising 100 odorant receptor genes in mouse.", "journal": "Mamm. Genome", "date": "2000", "authors": "Xie S.Y., Mombaerts P., Feinstein P.", "evidence": [ { "database": "UniProtKB", "id": "Q60882", "url": "https://www.uniprot.org/uniprot/Q60882" } ], "reference": [ { "type": "PubMed", "id": "11130974", "url": "https://glygen.org/publication/PubMed/11130974" } ] }, { "title": "The chromosomal distribution of mouse odorant receptor genes.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1996", "authors": "Sullivan SL, Adamson MC, Ressler KJ, Kozak CA, Buck LB", "evidence": [ { "database": "UniProtKB", "id": "Q60882", "url": "https://www.uniprot.org/uniprot/Q60882" } ], "reference": [ { "type": "PubMed", "id": "8570653", "url": "https://glygen.org/publication/PubMed/8570653" } ] } ], "pathway": [ { "id": "mmu:258310", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:258310", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q15620-1", "protein_name": "Olfactory receptor 8B8", "gene_name": "OR8B8", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAAENSSFVTQFILAGLTDQPGVQIPLFFLFLGFYVVTVVGNLGLITLIRLNSHLHTPMYFFLYNLSFIDFCYSSVITPKMLMSFVLKKNSISYAGCMTQLFFFLFFVVSESFILSAMAYDRYVAICNPLLYMVTMSPQVCFLLLLGVYGMGFAGAMAHTACMMGVTFCANNLVNHYMCDILPLLECACTSTYVNELVVFVVVGIDIGVPTVTIFISYALILSSIFHIDSTEGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPFSLLAMNQGKVSSLFYTTVVPMLNPLIYSLRNKDVKVALKKILNKNAFS", "length": 311 }, "evidence": [ { "id": "45224622", "url": "http://www.informatics.jax.org/homology/45224622", "database": "MGI" }, { "id": "Q60882", "url": "https://omabrowser.org/oma/group/Q60882/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "Q60882", "url": "https://www.uniprot.org/uniprot/Q60882" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "Q60882", "url": "https://www.uniprot.org/uniprot/Q60882" } ], "pmid": "" }, { "name": "odorant binding", "id": "GO:0005549", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005549", "evidence": [ { "database": "UniProtKB", "id": "Q60882", "url": "https://www.uniprot.org/uniprot/Q60882" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q60882", "url": "https://www.uniprot.org/uniprot/Q60882" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q60882", "url": "https://www.uniprot.org/uniprot/Q60882" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "Q60882", "url": "https://www.uniprot.org/uniprot/Q60882" } ], "pmid": "" }, { "name": "sensory perception of smell", "id": "GO:0007608", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007608", "evidence": [ { "database": "UniProtKB", "id": "Q60882", "url": "https://www.uniprot.org/uniprot/Q60882" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" }, { "start_pos": 64, "end_pos": 66, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }