{ "uniprot_canonical_ac": "Q5XFW4-1", "uniprot_ac": "Q5XFW4", "uniprot_id": "Q5XFW4_RAT", "mass": { "chemical_mass": 20541.0, "monoisotopic_mass": 20541.0 }, "refseq": { "ac": "NP_001006986", "name": "39S ribosomal protein L13, mitochondrial", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001006986" }, "gene_names": [ { "name": "Mrpl13", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5XFW4", "id": "Q5XFW4" }, { "name": "Mrpl13", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001006986", "id": "NP_001006986" } ], "protein_names": [ { "name": "39S ribosomal protein L13, mitochondrial", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001006986", "id": "NP_001006986" }, { "name": "Mitochondrial ribosomal protein L13", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5XFW4" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q5XFW4", "url": "https://www.uniprot.org/uniprot/Q5XFW4" } ], "common_name": "Rat" } ], "gene": [ { "name": "Mrpl13", "url": "https://www.uniprot.org/uniprot/Q5XFW4", "locus": { "chromosome": "7", "start_pos": 86951541, "end_pos": 86973577, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000004401", "url": "https://www.ensembl.org/id/ENSRNOG00000004401" } ] } } ], "crossref": [ { "id": "ENSRNOG00000004401", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000004401", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00392", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00392", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "299938", "url": "https://www.ncbi.nlm.nih.gov/gene/299938", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR005822", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005822", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005823", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005823", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036899", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036899", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:299938", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:299938", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "DFVVIIN", "url": "https://omabrowser.org/oma/group/DFVVIIN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "379801at2759", "url": "http://www.orthodb.org/?query=379801at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11545", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11545", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11545:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11545:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00572", "url": "http://pfam.xfam.org/family/PF00572", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5389840", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5389840", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5419276", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5419276", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001006986", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001006986", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1359587", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1359587", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "Q5XFW4", "url": "https://www.uniprot.org/uniprot/Q5XFW4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5XFW4-1", "url": "https://www.uniprot.org/uniprot/Q5XFW4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSFSKAPQQWATFARMWYLLDGKMQPPGKLAAIASNKLQGLHKPVYHQLSDCGDHVVIINTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLKDPVAIVKLATYGMLPKNLHRRTMMQRLHLFPDEDIPEDILKNLVEELPQPRRVPKRLDEYTQEEIEAFPRVWAPPDDFRI", "length": 178, "header": "tr|Q5XFW4-1|Q5XFW4_RAT Isoform 1 of Mitochondrial ribosomal protein L13 OS=Rattus norvegicus OX=10116 GN=Mrpl13 PE=3 SV=1 CANONICAL=Q5XFW4-1" }, "isoforms": [ { "isoform_ac": "Q5XFW4-1", "url": "", "sequence": { "sequence": "MSSFSKAPQQWATFARMWYLLDGKMQPPGKLAAIASNKLQGLHKPVYHQLSDCGDHVVIINTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLKDPVAIVKLATYGMLPKNLHRRTMMQRLHLFPDEDIPEDILKNLVEELPQPRRVPKRLDEYTQEEIEAFPRVWAPPDDFRI", "length": 178, "header": "tr|Q5XFW4-1|Q5XFW4_RAT Isoform 1 of Mitochondrial ribosomal protein L13 OS=Rattus norvegicus OX=10116 GN=Mrpl13 PE=3 SV=1 CANONICAL=Q5XFW4-1" }, "locus": { "chromosome": "7", "start_pos": 86973095, "end_pos": 86951771, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000005815.7", "url": "https://www.ensembl.org/id/ENSRNOT00000005815.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000005815.3", "url": "https://www.ensembl.org/id/ENSRNOP00000005815.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:299938", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:299938", "resource": "KEGG Pathway" }, { "id": "R-RNO-5389840", "name": "Mitochondrial translation elongation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5389840", "resource": "Reactome", "description": "Mitochondrial translation elongation" }, { "id": "R-RNO-5419276", "name": "Mitochondrial translation termination", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5419276", "resource": "Reactome", "description": "Mitochondrial translation termination" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9BYD1-1", "protein_name": "Large ribosomal subunit protein uL13m", "gene_name": "MRPL13", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPEDYRL", "length": 178 }, "evidence": [ { "id": "45233732", "url": "http://www.informatics.jax.org/homology/45233732", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9D1P0-1", "protein_name": "Large ribosomal subunit protein uL13m", "gene_name": "Mrpl13", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSSFSRAPQQWATFARMWYLLDGKMQPPGKLAVIASNKLQGLNKPVYHQLSDCGDHVVIINTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHRKDPVAIVKLAIYGMLPKNLHRRTMMQRLHLFPDEDIPEDILKNLVEELPQPRRVPKRLDEYTQEEIEAFPRVWTPPDDFRM", "length": 178 }, "evidence": [ { "id": "45233732", "url": "http://www.informatics.jax.org/homology/45233732", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "mitochondrial large ribosomal subunit", "id": "GO:0005762", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005762", "evidence": [ { "database": "UniProtKB", "id": "Q5XFW4", "url": "https://www.uniprot.org/uniprot/Q5XFW4" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q5XFW4", "url": "https://www.uniprot.org/uniprot/Q5XFW4" } ], "pmid": "" }, { "name": "ribosome", "id": "GO:0005840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005840", "evidence": [ { "database": "UniProtKB", "id": "Q5XFW4", "url": "https://www.uniprot.org/uniprot/Q5XFW4" } ], "pmid": "" }, { "name": "mitochondrial ribosome", "id": "GO:0005761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005761", "evidence": [ { "database": "UniProtKB", "id": "Q5XFW4", "url": "https://www.uniprot.org/uniprot/Q5XFW4" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "mRNA binding", "id": "GO:0003729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003729", "evidence": [ { "database": "UniProtKB", "id": "Q5XFW4", "url": "https://www.uniprot.org/uniprot/Q5XFW4" } ], "pmid": "" }, { "name": "structural constituent of ribosome", "id": "GO:0003735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003735", "evidence": [ { "database": "UniProtKB", "id": "Q5XFW4", "url": "https://www.uniprot.org/uniprot/Q5XFW4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "translation", "id": "GO:0006412", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006412", "evidence": [ { "database": "UniProtKB", "id": "Q5XFW4", "url": "https://www.uniprot.org/uniprot/Q5XFW4" } ], "pmid": "" }, { "name": "negative regulation of translation", "id": "GO:0017148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017148", "evidence": [ { "database": "UniProtKB", "id": "Q5XFW4", "url": "https://www.uniprot.org/uniprot/Q5XFW4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }