{ "uniprot_canonical_ac": "Q5W5W9-2", "uniprot_ac": "Q5W5W9", "uniprot_id": "RES18_HUMAN", "mass": { "chemical_mass": 24956.0, "monoisotopic_mass": 24956.0 }, "refseq": { "ac": "NP_001007090", "name": "regulated endocrine-specific protein 18", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007090" }, "gene_names": [ { "name": "RESP18", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5W5W9", "id": "Q5W5W9" }, { "name": "RESP18", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007090", "id": "NP_001007090" } ], "protein_names": [ { "name": "Regulated endocrine-specific protein 18", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q5W5W9" }, { "name": "regulated endocrine-specific protein 18 homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007090", "id": "NP_001007090" }, { "name": "regulated endocrine-specific protein 18", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007090", "id": "NP_001007090" } ], "function": [ { "annotation": "May play an important regulatory role in corticotrophs.", "evidence": [ { "database": "UniProtKB", "id": "Q5W5W9", "url": "https://www.uniprot.org/uniprot/Q5W5W9#function" } ] }, { "annotation": "Over-expression of RESP18 resulted in aggravated cell death induced by dopaminergic neurotoxins.", "evidence": [ { "database": "RefSeq", "id": "NP_001007090", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007090" }, { "database": "PubMed", "id": "23319378", "url": "https://glygen.org/publication/PubMed/23319378" } ] }, { "annotation": "RESP18 is a luminal protein of DCVs and its expression is regulated by exposure to glucose.", "evidence": [ { "database": "RefSeq", "id": "NP_001007090", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007090" }, { "database": "PubMed", "id": "17951542", "url": "https://glygen.org/publication/PubMed/17951542" } ] }, { "annotation": "RESP18HD is required for efficient sorting of ICA512 to secretory granules: RESP18HD is a key determinant for ICA512 granule targeting.", "evidence": [ { "database": "RefSeq", "id": "NP_001007090", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007090" }, { "database": "PubMed", "id": "26836020", "url": "https://glygen.org/publication/PubMed/26836020" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "18.51", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000182698", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182698" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "16.41", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000182698", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182698" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000182698", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182698" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "16.94", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000182698", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182698" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "16.34", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000182698", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182698" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "18.18", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000182698", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182698" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "16.88", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000182698", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182698" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "18.79", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000182698", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182698" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "21.65", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000182698", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182698" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "Q5W5W9", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q5W5W9" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "Q5W5W9", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q5W5W9" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "Q5W5W9", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q5W5W9" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "Q5W5W9", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q5W5W9" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "Q5W5W9", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q5W5W9" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "Q5W5W9", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q5W5W9" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5W5W9", "url": "https://www.uniprot.org/uniprot/Q5W5W9" } ], "common_name": "Human" } ], "gene": [ { "name": "RESP18", "url": "https://www.uniprot.org/uniprot/Q5W5W9", "locus": { "chromosome": "2", "start_pos": 219327407, "end_pos": 219333177, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000182698", "url": "https://www.ensembl.org/id/ENSG00000182698" } ] } } ], "crossref": [ { "id": "ENSG00000182698", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182698", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "RESP18", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=RESP18", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "389075", "url": "https://www.ncbi.nlm.nih.gov/gene/389075", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "33762", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=33762", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR024833", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024833", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029403", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029403", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:389075", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:389075", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "612721", "url": "http://www.omim.org/entry/612721", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_Q5W5W9", "url": "https://www.nextprot.org/entry/NX_Q5W5W9", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "Q5W5W9", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q5W5W9", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "LFWKNDI", "url": "https://omabrowser.org/oma/group/LFWKNDI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5266782at2759", "url": "http://www.orthodb.org/?query=5266782at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR17314", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR17314", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR17314:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR17314:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF14948", "url": "http://pfam.xfam.org/family/PF14948", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "Q5W5W9", "url": "https://pharos.nih.gov/targets/Q5W5W9", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_Q5W5W9", "url": "http://purl.obolibrary.org/obo/PR_Q5W5W9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001007090", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007090", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q5W5W9", "url": "https://www.uniprot.org/uniprot/Q5W5W9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5W5W9-1", "url": "https://www.uniprot.org/uniprot/Q5W5W9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5W5W9-2", "url": "https://www.uniprot.org/uniprot/Q5W5W9-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5W5W9-3", "url": "https://www.uniprot.org/uniprot/Q5W5W9-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAVDVEFGVAGWWEAAAPLSPSAVAATFTETWPGSERAEPGRIQHPLWPGSSEGLQLLVCFLLLNSCPGGCSDTSAHDGQDQVGVGQLWPLQGFATPVFQHLQVVLQQIIPQGLFWKDDITQDAMIQKMEHASRLHPQEPCLKDGKALFPTKTTESPLAKVNRDQCFTSEVVSKALKQEVANPVKITYRCSYGGLDMMQAPGPSKEEIIYKIMRLLWATSYCGPQPCG", "length": 228, "header": "sp|Q5W5W9-2|RES18_HUMAN Isoform 2 of Regulated endocrine-specific protein 18 OS=Homo sapiens OX=9606 GN=RESP18 PE=2 SV=2 CANONICAL=Q5W5W9-2" }, "isoforms": [ { "isoform_ac": "Q5W5W9-1", "url": "", "sequence": { "sequence": "MIQKMEHASRLHPQEPCLKDGKALFPTKTTEQEEKLQLLFPSETHSPLAKVNRDQCFTSEVVSKALKQEVANPVKGFSGPLPTVGRNPVAD", "length": 91, "header": "sp|Q5W5W9-1|RES18_HUMAN Isoform 1 of Regulated endocrine-specific protein 18 OS=Homo sapiens OX=9606 GN=RESP18 PE=2 SV=2 CANONICAL=Q5W5W9-2" }, "locus": { "chromosome": "2", "start_pos": 219329729, "end_pos": 219327516, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000392083.5", "url": "https://www.ensembl.org/id/ENST00000392083.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000375933.1", "url": "https://www.ensembl.org/id/ENSP00000375933.1" } ] } }, { "isoform_ac": "Q5W5W9-2", "url": "", "sequence": { "sequence": "MAVDVEFGVAGWWEAAAPLSPSAVAATFTETWPGSERAEPGRIQHPLWPGSSEGLQLLVCFLLLNSCPGGCSDTSAHDGQDQVGVGQLWPLQGFATPVFQHLQVVLQQIIPQGLFWKDDITQDAMIQKMEHASRLHPQEPCLKDGKALFPTKTTESPLAKVNRDQCFTSEVVSKALKQEVANPVKITYRCSYGGLDMMQAPGPSKEEIIYKIMRLLWATSYCGPQPCG", "length": 228, "header": "sp|Q5W5W9-2|RES18_HUMAN Isoform 2 of Regulated endocrine-specific protein 18 OS=Homo sapiens OX=9606 GN=RESP18 PE=2 SV=2 CANONICAL=Q5W5W9-2" }, "locus": { "chromosome": "2", "start_pos": 219333177, "end_pos": 219327520, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000333527.6", "url": "https://www.ensembl.org/id/ENST00000333527.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000330269.5", "url": "https://www.ensembl.org/id/ENSP00000330269.5" } ] } }, { "isoform_ac": "Q5W5W9-3", "url": "", "sequence": { "sequence": "MWKALARFLADTTILPLDGQDQVGVGQLWPLQGFATPVFQHLQVVLQQIIPQGLFWKDDITQDAMIQKMEHASRLHPQEPCLKDGKALFPTKTTESPLAKVNRDQCFTSEVVSKALKQEVANPVKITYRCSYGGLDMMQAPGPSKEEIIYKIMRLLWATSYCGPQPCG", "length": 168, "header": "sp|Q5W5W9-3|RES18_HUMAN Isoform 3 of Regulated endocrine-specific protein 18 OS=Homo sapiens OX=9606 GN=RESP18 PE=2 SV=2 CANONICAL=Q5W5W9-2" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q5W5W9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q5W5W9" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "RESP18, a homolog of the luminal domain IA-2, is found in dense core vesicles in pancreatic islet cells and is induced by high glucose.", "journal": "J. Endocrinol.", "date": "2007", "authors": "Zhang G, Hirai H, Cai T, Miura J, Yu P, Huang H, Schiller MR, Swaim WD, Leapman RD, Notkins AL", "evidence": [ { "database": "UniProtKB", "id": "Q5W5W9", "url": "https://www.uniprot.org/uniprot/Q5W5W9" }, { "database": "RefSeq", "id": "NP_001007090", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007090" } ], "reference": [ { "type": "PubMed", "id": "17951542", "url": "https://glygen.org/publication/PubMed/17951542" } ] }, { "title": "RESP18 is involved in the cytotoxicity of dopaminergic neurotoxins in MN9D cells.", "journal": "Neurotoxicity research", "date": "2013", "authors": "Huang Y, Xu J, Liang M, Hong X, Suo H, Liu J, Yu M, Huang F", "evidence": [ { "database": "RefSeq", "id": "NP_001007090", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007090" } ], "reference": [ { "type": "PubMed", "id": "23319378", "url": "https://glygen.org/publication/PubMed/23319378" } ] }, { "title": "Biochemical, biophysical, and functional properties of ICA512/IA-2 RESP18 homology domain.", "journal": "Biochimica et biophysica acta", "date": "2016", "authors": "Sosa L, Torkko JM, Primo ME, Llovera RE, Toledo PL, Rios AS, Flecha FL, Trabucchi A, Valdez SN, Poskus E, Solimena M, Ermacora MR", "evidence": [ { "database": "RefSeq", "id": "NP_001007090", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001007090" } ], "reference": [ { "type": "PubMed", "id": "26836020", "url": "https://glygen.org/publication/PubMed/26836020" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q5W5W9", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q5W5W9" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] } ], "pathway": [ { "id": "hsa:389075", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:389075", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P47939-1", "protein_name": "Regulated endocrine-specific protein 18", "gene_name": "Resp18", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MQSSLKPAGSGHLQLLVCFLLLYSRPGSCSDINAHDGQGQVGSEQLWTFQGLIASVFQYLQLIFHQIVPEGMFWADDIAYELMTKKVEHLSRLHPQYPCRKDMKAVSPTANAGVRSKQEEKLQLLSPQKSPTVKVNRDRCFTTKVIPKATKQEATHPTKGFFGPFPTVGLNLVAD", "length": 175 }, "evidence": [ { "id": "45243463", "url": "http://www.informatics.jax.org/homology/45243463", "database": "MGI" }, { "id": "Q5W5W9", "url": "https://omabrowser.org/oma/group/Q5W5W9/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P47940-1", "protein_name": "Regulated endocrine-specific protein 18", "gene_name": "Resp18", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MQSSLKPAGSGVLQLLVCFLLLYSRPSSCSDINAHDGQGQVGSEQLWTFQGLVASVFQYLQLLFHHIVPQGMFWTDDIAYELMTKKVEHLSRLHPQYPCRKEGKVVSPIATTGVRGKQEEKLRLLSPQKSPAVKVNRDRCFTTKVIPKATKQEVTHPSKGFFGPFPTVGLNLVAD", "length": 175 }, "evidence": [ { "id": "45243463", "url": "http://www.informatics.jax.org/homology/45243463", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "Q5W5W9", "url": "https://www.uniprot.org/uniprot/Q5W5W9" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "Q5W5W9", "url": "https://www.uniprot.org/uniprot/Q5W5W9" } ], "pmid": "" }, { "name": "cytoplasmic vesicle", "id": "GO:0031410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "evidence": [ { "database": "UniProtKB", "id": "Q5W5W9", "url": "https://www.uniprot.org/uniprot/Q5W5W9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }