{
    "uniprot_canonical_ac": "Q5UBV8-1",
    "uniprot_ac": "Q5UBV8",
    "uniprot_id": "TNF15_MOUSE",
    "mass": {
        "chemical_mass": 27723.0,
        "monoisotopic_mass": 27723.0
    },
    "refseq": {
        "ac": "NP_796345",
        "name": "tumor necrosis factor ligand superfamily member 15",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345"
    },
    "gene_names": [
        {
            "name": "Tnfsf15",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q5UBV8",
            "id": "Q5UBV8"
        },
        {
            "name": "Tl1; Tl1a; Tnlg1b; Vegi",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345",
            "id": "NP_796345"
        },
        {
            "name": "Tl1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q5UBV8",
            "id": "Q5UBV8"
        },
        {
            "name": "Tnfsf15",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345",
            "id": "NP_796345"
        },
        {
            "name": "Tnlg1b",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q5UBV8",
            "id": "Q5UBV8"
        },
        {
            "name": "Vegi",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q5UBV8",
            "id": "Q5UBV8"
        }
    ],
    "protein_names": [
        {
            "name": "Tumor necrosis factor ligand superfamily member 15",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q5UBV8"
        },
        {
            "name": "TNF ligand-related molecule 1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q5UBV8"
        },
        {
            "name": "Vascular endothelial cell growth inhibitor",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q5UBV8"
        },
        {
            "name": "tumor necrosis factor ligand superfamily member 15",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345",
            "id": "NP_796345"
        },
        {
            "name": "vascular endothelial growth inhibitor; bM20K13.3 (tumor necrosis factor (ligand) superfamily, member 15); tumor necrosis factor ligand 1b; TNF ligand-related molecule 1; vascular endothelial cell growth inhibitor",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345",
            "id": "NP_796345"
        }
    ],
    "function": [
        {
            "annotation": "A Protective Role of Tumor Necrosis Factor Superfamily-15 in Intracerebral Hemorrhage-Induced Secondary Brain Injury.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_796345",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345"
                },
                {
                    "database": "PubMed",
                    "id": "34596444",
                    "url": "https://glygen.org/publication/PubMed/34596444"
                }
            ]
        },
        {
            "annotation": "Findings suggest that the transcription factor NF-kappaB plays an important role in the regulation of VEGI expression",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_796345",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345"
                },
                {
                    "database": "PubMed",
                    "id": "15702971",
                    "url": "https://glygen.org/publication/PubMed/15702971"
                }
            ]
        },
        {
            "annotation": "Identification of a novel role for TL1A/DR3 deficiency in acute respiratory distress syndrome that exacerbates alveolar epithelial disruption. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_796345",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345"
                },
                {
                    "database": "PubMed",
                    "id": "37434162",
                    "url": "https://glygen.org/publication/PubMed/37434162"
                }
            ]
        },
        {
            "annotation": "Induction of intestinal inflammation is associated with significant up-regulation of TL1A and tm DR3 in the inflamed mucosa",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_796345",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345"
                },
                {
                    "database": "PubMed",
                    "id": "16698931",
                    "url": "https://glygen.org/publication/PubMed/16698931"
                }
            ]
        },
        {
            "annotation": "Neonatal CD4+ CD3- cells up-regulate both CD30L and OX40L after adoptive transfer into an adult recipient",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_796345",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345"
                },
                {
                    "database": "PubMed",
                    "id": "16920944",
                    "url": "https://glygen.org/publication/PubMed/16920944"
                }
            ]
        },
        {
            "annotation": "Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis (By similarity). Promotes splenocyte alloactivation.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q5UBV8",
                    "url": "https://www.uniprot.org/uniprot/Q5UBV8#function"
                },
                {
                    "database": "PubMed",
                    "id": "11911831",
                    "url": "https://glygen.org/publication/PubMed/11911831"
                }
            ]
        },
        {
            "annotation": "TNFSF15 facilitates differentiation and polarization of macrophages toward M1 phenotype to inhibit tumor growth. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_796345",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345"
                },
                {
                    "database": "PubMed",
                    "id": "35127254",
                    "url": "https://glygen.org/publication/PubMed/35127254"
                }
            ]
        },
        {
            "annotation": "Targeting TL1A/DR3 Signaling Offers a Therapeutic Advantage to Neutralizing IL13/IL4Ralpha in Muco-Secretory Fibrotic Disorders. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_796345",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345"
                },
                {
                    "database": "PubMed",
                    "id": "34305924",
                    "url": "https://glygen.org/publication/PubMed/34305924"
                }
            ]
        },
        {
            "annotation": "Tumor necrosis factor ligand-related molecule 1A maintains blood-retinal barrier via modulating SHP-1-Src-VE-cadherin signaling in diabetic retinopathy.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_796345",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345"
                },
                {
                    "database": "PubMed",
                    "id": "34679191",
                    "url": "https://glygen.org/publication/PubMed/34679191"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q5UBV8",
                    "url": "https://www.uniprot.org/uniprot/Q5UBV8"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Tnfsf15",
            "url": "https://www.uniprot.org/uniprot/Q5UBV8",
            "locus": {
                "chromosome": "4",
                "start_pos": 63642840,
                "end_pos": 63663350,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000050395",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000050395"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000050395",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000050395",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "cd00184",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00184",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "326623",
            "url": "https://www.ncbi.nlm.nih.gov/gene/326623",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR006052",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR006052",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR006053",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR006053",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR008983",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR008983",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:326623",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:326623",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "2180140",
            "url": "http://www.informatics.jax.org/marker/MGI:2180140",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "ACVFQTP",
            "url": "https://omabrowser.org/oma/group/ACVFQTP/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "2909163at2759",
            "url": "http://www.orthodb.org/?query=2909163at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11471",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11471",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11471:SF24",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11471:SF24",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00229",
            "url": "http://pfam.xfam.org/family/PF00229",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q5UBV8",
            "url": "http://purl.obolibrary.org/obo/PR_Q5UBV8",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-MMU-5669034",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5669034",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_796345",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A0U5J7F3",
            "url": "https://www.uniprot.org/uniprot/A0A0U5J7F3",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A0U5J7F3-1",
            "url": "https://www.uniprot.org/uniprot/A0A0U5J7F3-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "B2RR33",
            "url": "https://www.uniprot.org/uniprot/B2RR33",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "B2RR33-1",
            "url": "https://www.uniprot.org/uniprot/B2RR33-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q5UBV8",
            "url": "https://www.uniprot.org/uniprot/Q5UBV8",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q5UBV8-1",
            "url": "https://www.uniprot.org/uniprot/Q5UBV8-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MAEELGLGFGEGVPVEVLPEGCRHRPEARAGLAARSKACLALTCCLLSFPILAGLSTLLMAGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL",
        "length": 252,
        "header": "sp|Q5UBV8-1|TNF15_MOUSE Isoform 1 of Tumor necrosis factor ligand superfamily member 15  OS=Mus musculus OX=10090 GN=Tnfsf15 PE=2 SV=2 CANONICAL=Q5UBV8-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A0U5J7F3-1",
            "url": "",
            "sequence": {
                "sequence": "MGGSLVRRDQKSLQDSRRMAEELGLGFGEGVPVEVLPEGCRHRPEARAGLAARSKACLALTCCLLSFPILAGLSTLLMAGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITMVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGATFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL",
                "length": 270,
                "header": "tr|A0A0U5J7F3-1|TNF15_MOUSE Computationally mapped isoform of Tumor necrosis factor ligand superfamily member 15  OS=Mus musculus OX=10090 GN=Tnfsf15 PE=2 SV=1 CANONICAL=Q5UBV8-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 63663321,
                "end_pos": 63647829,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000239480.2",
                        "url": "https://www.ensembl.org/id/ENSMUST00000239480.2"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000159365.2",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000159365.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "B2RR33-1",
            "url": "",
            "sequence": {
                "sequence": "MAEELGLGFGEGVPVEVLPEGCRHRPEARAGLAARSKACLALTCCLLSFPILAGLSTLLMAGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITMVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGATFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL",
                "length": 252,
                "header": "tr|B2RR33-1|TNF15_MOUSE Computationally mapped isoform of Tumor necrosis factor ligand superfamily member 15  OS=Mus musculus OX=10090 GN=Tnfsf15 PE=2 SV=1 CANONICAL=Q5UBV8-1"
            },
            "locus": {
                "chromosome": "4",
                "start_pos": 63663267,
                "end_pos": 63647829,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000062246.8",
                        "url": "https://www.ensembl.org/id/ENSMUST00000062246.8"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000050144.8",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000050144.8"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q5UBV8-1",
            "url": "",
            "sequence": {
                "sequence": "MAEELGLGFGEGVPVEVLPEGCRHRPEARAGLAARSKACLALTCCLLSFPILAGLSTLLMAGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL",
                "length": 252,
                "header": "sp|Q5UBV8-1|TNF15_MOUSE Isoform 1 of Tumor necrosis factor ligand superfamily member 15  OS=Mus musculus OX=10090 GN=Tnfsf15 PE=2 SV=2 CANONICAL=Q5UBV8-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 137,
            "start_aa": "Asn",
            "end_pos": 137,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn137",
            "evidence": [
                {
                    "id": "Q5UBV8",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q5UBV8#ptm_processing"
                }
            ]
        },
        {
            "glytoucan_ac": "",
            "type": "N-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "N",
            "relation": "attached",
            "comment": "N-linked (GlcNAc...) asparagine",
            "start_pos": 230,
            "start_aa": "Asn",
            "end_pos": 230,
            "end_aa": "Asn",
            "residue": "Asn",
            "site_lbl": "Asn230",
            "evidence": [
                {
                    "id": "Q5UBV8",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q5UBV8#ptm_processing"
                }
            ]
        }
    ],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "glycoprotein",
        "glycoprotein_predicted"
    ],
    "publication": [
        {
            "title": "TL1A is a TNF-like ligand for DR3 and TR6/DcR3 and functions as a T cell costimulator.",
            "journal": "Immunity",
            "date": "2002",
            "authors": "Migone TS, Zhang J, Luo X, Zhuang L, Chen C, Hu B, Hong JS, Perry JW, Chen SF, Zhou JX, Cho YH, Ullrich S, Kanakaraj P, Carrell J, Boyd E, Olsen HS, Hu G, Pukac L, Liu D, Ni J, Kim S, Gentz R, Feng P, Moore PA, Ruben SM, Wei P",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q5UBV8",
                    "url": "https://www.uniprot.org/uniprot/Q5UBV8"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11911831",
                    "url": "https://glygen.org/publication/PubMed/11911831"
                }
            ]
        },
        {
            "title": "Characterization of cis-regulatory elements of the vascular endothelial growth inhibitor gene promoter.",
            "journal": "Biochem. J.",
            "date": "2005",
            "authors": "Xiao Q, Hsu CY, Chen H, Ma X, Xu J, Lee JM",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q5UBV8",
                    "url": "https://www.uniprot.org/uniprot/Q5UBV8"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_796345",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15702971",
                    "url": "https://glygen.org/publication/PubMed/15702971"
                }
            ]
        },
        {
            "title": "Role of TL1A and its receptor DR3 in two models of chronic murine ileitis.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2006",
            "authors": "Bamias G, Mishina M, Nyce M, Ross WG, Kollias G, Rivera-Nieves J, Pizarro TT, Cominelli F",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_796345",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16698931",
                    "url": "https://glygen.org/publication/PubMed/16698931"
                }
            ]
        },
        {
            "title": "Neonatal and adult CD4+ CD3- cells share similar gene expression profile, and neonatal cells up-regulate OX40 ligand in response to TL1A (TNFSF15).",
            "journal": "Journal of immunology (Baltimore, Md. : 1950)",
            "date": "2006",
            "authors": "Kim MY, Toellner KM, White A, McConnell FM, Gaspal FM, Parnell SM, Jenkinson E, Anderson G, Lane PJ",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_796345",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16920944",
                    "url": "https://glygen.org/publication/PubMed/16920944"
                }
            ]
        },
        {
            "title": "Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.",
            "journal": "Immunogenetics",
            "date": "2016",
            "authors": "Premzl M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0U5J7F3",
                    "url": "https://www.uniprot.org/uniprot/A0A0U5J7F3"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26646413",
                    "url": "https://glygen.org/publication/PubMed/26646413"
                }
            ]
        },
        {
            "title": "Targeting TL1A/DR3 Signaling Offers a Therapeutic Advantage to Neutralizing IL13/IL4Ralpha in Muco-Secretory Fibrotic Disorders.",
            "journal": "Frontiers in immunology",
            "date": "2021",
            "authors": "Steele H, Sachen K, McKnight AJ, Soloff R, Herro R",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_796345",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "34305924",
                    "url": "https://glygen.org/publication/PubMed/34305924"
                }
            ]
        },
        {
            "title": "A Protective Role of Tumor Necrosis Factor Superfamily-15 in Intracerebral Hemorrhage-Induced Secondary Brain Injury.",
            "journal": "ASN neuro",
            "date": "2021",
            "authors": "Yang GL, Wang S, Zhang S, Liu Y, Liu X, Wang D, Wei H, Xiong J, Zhang ZS, Wang Z, Li LY, Zhang J",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_796345",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "34596444",
                    "url": "https://glygen.org/publication/PubMed/34596444"
                }
            ]
        },
        {
            "title": "Tumor necrosis factor ligand-related molecule 1A maintains blood-retinal barrier via modulating SHP-1-Src-VE-cadherin signaling in diabetic retinopathy.",
            "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
            "date": "2021",
            "authors": "Li J, Xie R, Jiang F, Li Y, Zhu Y, Liu Z, Liao M, Liu Y, Meng X, Chen S, Yu J, Du M, Wang X, Chen Y, Yan H",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_796345",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "34679191",
                    "url": "https://glygen.org/publication/PubMed/34679191"
                }
            ]
        },
        {
            "title": "TNFSF15 facilitates differentiation and polarization of macrophages toward M1 phenotype to inhibit tumor growth.",
            "journal": "Oncoimmunology",
            "date": "2022",
            "authors": "Zhao CC, Han QJ, Ying HY, Gu XX, Yang N, Li LY, Zhang QZ",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_796345",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "35127254",
                    "url": "https://glygen.org/publication/PubMed/35127254"
                }
            ]
        },
        {
            "title": "Identification of a novel role for TL1A/DR3 deficiency in acute respiratory distress syndrome that exacerbates alveolar epithelial disruption.",
            "journal": "Respiratory research",
            "date": "2023-07-11",
            "authors": "Zhang Dong, Zhang Jianning, Zhang Jintao, Ji Xiang, Qi Qian, Xu Jiawei, Pan Yun, Liu Xiaofei, Sun Fang, Zeng Rong, Dong Liang",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_796345",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_796345"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "37434162",
                    "url": "https://glygen.org/publication/PubMed/37434162"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:326623",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:326623",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-MMU-5669034",
            "name": "TNFs bind their physiological receptors",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5669034",
            "resource": "Reactome",
            "description": "TNFs bind their physiological receptors"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "O95150-1",
            "protein_name": "Tumor necrosis factor ligand superfamily member 15",
            "gene_name": "TNFSF15",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL",
                "length": 251
            },
            "evidence": [
                {
                    "id": "45234715",
                    "url": "http://www.informatics.jax.org/homology/45234715",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q8K3Y7-1",
            "protein_name": "Tumor necrosis factor ligand superfamily member 15",
            "gene_name": "Tnfsf15",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MAEELGLGFGEAVPVEMLPEGCRHRREARTGLAARSKACLALTCCLLSFPILAGLSTLLMTGQLRIPGKDCMFPTVTEERSAPSAQPVYTPSRDKPKAHLTIMRQTPVPHLKNELAALHWENNLGMAFTKNRMNYTNKFLVIPESGDYFIYSQITFRGTTSECGDISRVRRPKKPDSITVVITKVADSYPEPAHLLTGTKSVCEISSNWFQPIYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLI",
                "length": 252
            },
            "evidence": [
                {
                    "id": "45234715",
                    "url": "http://www.informatics.jax.org/homology/45234715",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 3,
                "go_terms": [
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q5UBV8",
                                "url": "https://www.uniprot.org/uniprot/Q5UBV8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "extracellular space",
                        "id": "GO:0005615",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q5UBV8",
                                "url": "https://www.uniprot.org/uniprot/Q5UBV8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "membrane",
                        "id": "GO:0016020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q5UBV8",
                                "url": "https://www.uniprot.org/uniprot/Q5UBV8"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 4,
                "go_terms": [
                    {
                        "name": "immune response",
                        "id": "GO:0006955",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q5UBV8",
                                "url": "https://www.uniprot.org/uniprot/Q5UBV8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "activation of cysteine-type endopeptidase activity involved in apoptotic process",
                        "id": "GO:0006919",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006919",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q5UBV8",
                                "url": "https://www.uniprot.org/uniprot/Q5UBV8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "activation of NF-kappaB-inducing kinase activity",
                        "id": "GO:0007250",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007250",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q5UBV8",
                                "url": "https://www.uniprot.org/uniprot/Q5UBV8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of cytokine production",
                        "id": "GO:0001819",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001819",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q5UBV8",
                                "url": "https://www.uniprot.org/uniprot/Q5UBV8"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 3,
                "go_terms": [
                    {
                        "name": "tumor necrosis factor receptor binding",
                        "id": "GO:0005164",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005164",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q5UBV8",
                                "url": "https://www.uniprot.org/uniprot/Q5UBV8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytokine activity",
                        "id": "GO:0005125",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q5UBV8",
                                "url": "https://www.uniprot.org/uniprot/Q5UBV8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "death receptor binding",
                        "id": "GO:0005123",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005123",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q5UBV8",
                                "url": "https://www.uniprot.org/uniprot/Q5UBV8"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 137,
            "end_pos": 139,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 230,
            "end_pos": 232,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                },
                {
                    "field": "total_sites",
                    "count": 2
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 2
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                },
                {
                    "field": "total_sites",
                    "count": 2
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 2
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 10
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}