{ "uniprot_canonical_ac": "Q5U419-1", "uniprot_ac": "Q5U419", "uniprot_id": "MFSD3_MOUSE", "mass": { "chemical_mass": 43165.0, "monoisotopic_mass": 43165.0 }, "refseq": { "ac": "NP_081398", "name": "major facilitator superfamily domain-containing protein 3", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081398" }, "gene_names": [ { "name": "Mfsd3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5U419", "id": "Q5U419" }, { "name": "2310010G13Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081398", "id": "NP_081398" }, { "name": "Mfsd3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081398", "id": "NP_081398" } ], "protein_names": [ { "name": "Major facilitator superfamily domain-containing protein 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q5U419" }, { "name": "major facilitator superfamily domain-containing protein 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081398", "id": "NP_081398" } ], "function": [ { "annotation": "Protein expression of MFSD3 is in mouse brain regions is specifically affected by altered nutrient uptake.", "evidence": [ { "database": "RefSeq", "id": "NP_081398", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081398" }, { "database": "PubMed", "id": "27981419", "url": "https://glygen.org/publication/PubMed/27981419" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q5U419", "url": "https://www.uniprot.org/uniprot/Q5U419" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Mfsd3", "url": "https://www.uniprot.org/uniprot/Q5U419", "locus": { "chromosome": "15", "start_pos": 76588439, "end_pos": 76585665, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000019080", "url": "https://www.ensembl.org/id/ENSMUSG00000019080" } ] } } ], "crossref": [ { "id": "ENSMUSG00000019080", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000019080", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd17485", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd17485", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "69572", "url": "https://www.ncbi.nlm.nih.gov/gene/69572", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR004752", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004752", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011701", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011701", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036259", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036259", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:69572", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:69572", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1916822", "url": "http://www.informatics.jax.org/marker/MGI:1916822", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "ANPFYVD", "url": "https://omabrowser.org/oma/group/ANPFYVD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2911730at2759", "url": "http://www.orthodb.org/?query=2911730at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12778", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12778", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12778:SF10", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12778:SF10", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07690", "url": "http://pfam.xfam.org/family/PF07690", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q5U419", "url": "http://purl.obolibrary.org/obo/PR_Q5U419", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_081398", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081398", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4J004", "url": "https://www.uniprot.org/uniprot/A0A0R4J004", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4J004-1", "url": "https://www.uniprot.org/uniprot/A0A0R4J004-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5U419", "url": "https://www.uniprot.org/uniprot/Q5U419", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5U419-1", "url": "https://www.uniprot.org/uniprot/Q5U419-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MHGKLLPLAGLYLVQGLPYGLQSSLLPILLRARGLSLTRVGLTKGLYAPWLLKLAWAPLVDRRGTPRVWLTLSTLSLGLVCGLLAVLPPPQAGQTGLPTTVMGLLLLLNLGAAVQDVALDTLAVQLLEPKELGPGNTVQVVAYKLGSALAGGGLLVLFPTLSWPLLFLLLAATYWLAAALAWAAPALGRLPWPQASEHTPHSSYLLQDLLAVPGTLWTAGFVLTYKLGEQGAGSLFPLLLLDHGASASDLGLWSGLGAVTCSIAGSSLGGALLARHWQPLKLLKTVLQLRLGSLACQTALLFHLNSPGASVDPGTVMRGAVLLSLCLQQFFGGVVTTATFTVMMHCSQLAPRALQATHYSFLATLELLGKLLLGTLAGVLADSLGPHLCFAVFLVLSALPVLDLRLAPSNLT", "length": 412, "header": "sp|Q5U419-1|MFSD3_MOUSE Isoform 1 of Major facilitator superfamily domain-containing protein 3 OS=Mus musculus OX=10090 GN=Mfsd3 PE=1 SV=1 CANONICAL=Q5U419-1" }, "isoforms": [ { "isoform_ac": "A0A0R4J004-1", "url": "", "sequence": { "sequence": "MHGKLLPLAGLYLVQGLPYGLQSSLLPILLRARGLSLTRVGLTKGLYAPWLLKLAWAPLVDRRGTPRVWLTLSTLSLGLVCGLLAVLPPPQAGQTGLPTTVMGLLLLLNLGAAVQDVALDTLAVQLLEPKELGPGNTVQVVAYKLGSALAGGGLLVLFPTLSWPLLFLLLAATYWLAAALAWAAPALGRLPWPQASEHTPHSSYLLQDLLAVPGTLWTAGFVLTYKLGEQGAGSLFPLLLLDHGASASDLGLWSGLGAVTCSIAGSSLGGALLARHWQPLKLLKTVLQLRLGSLACQTALLFHLNSPGASVDPGTVMRGAVLLSLCLQQFFGGVVTTATFTVMMHCSQLAPRALQATHYSFLATLELLGKLLPGTLAGVLADSLGPHLCFAVFLVLSALPVLDLRLAPSNLT", "length": 412, "header": "tr|A0A0R4J004-1|MFSD3_MOUSE Computationally mapped isoform of Major facilitator superfamily domain-containing protein 3 OS=Mus musculus OX=10090 GN=Mfsd3 PE=1 SV=1 CANONICAL=Q5U419-1" }, "locus": { "chromosome": "15", "start_pos": 76587633, "end_pos": 76585869, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000019224.9", "url": "https://www.ensembl.org/id/ENSMUST00000019224.9" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000019224.8", "url": "https://www.ensembl.org/id/ENSMUSP00000019224.8" } ] } }, { "isoform_ac": "Q5U419-1", "url": "", "sequence": { "sequence": "MHGKLLPLAGLYLVQGLPYGLQSSLLPILLRARGLSLTRVGLTKGLYAPWLLKLAWAPLVDRRGTPRVWLTLSTLSLGLVCGLLAVLPPPQAGQTGLPTTVMGLLLLLNLGAAVQDVALDTLAVQLLEPKELGPGNTVQVVAYKLGSALAGGGLLVLFPTLSWPLLFLLLAATYWLAAALAWAAPALGRLPWPQASEHTPHSSYLLQDLLAVPGTLWTAGFVLTYKLGEQGAGSLFPLLLLDHGASASDLGLWSGLGAVTCSIAGSSLGGALLARHWQPLKLLKTVLQLRLGSLACQTALLFHLNSPGASVDPGTVMRGAVLLSLCLQQFFGGVVTTATFTVMMHCSQLAPRALQATHYSFLATLELLGKLLLGTLAGVLADSLGPHLCFAVFLVLSALPVLDLRLAPSNLT", "length": 412, "header": "sp|Q5U419-1|MFSD3_MOUSE Isoform 1 of Major facilitator superfamily domain-containing protein 3 OS=Mus musculus OX=10090 GN=Mfsd3 PE=1 SV=1 CANONICAL=Q5U419-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The Novel Membrane-Bound Proteins MFSD1 and MFSD3 are Putative SLC Transporters Affected by Altered Nutrient Intake.", "journal": "J. Mol. Neurosci.", "date": "2017", "authors": "Perland E, Hellsten SV, Lekholm E, Eriksson MM, Arapi V, Fredriksson R", "evidence": [ { "database": "UniProtKB", "id": "Q5U419", "url": "https://www.uniprot.org/uniprot/Q5U419" }, { "database": "RefSeq", "id": "NP_081398", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081398" } ], "reference": [ { "type": "PubMed", "id": "27981419", "url": "https://glygen.org/publication/PubMed/27981419" } ] } ], "pathway": [ { "id": "mmu:69572", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:69572", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q4V8E5-1", "protein_name": "Major facilitator superfamily domain-containing protein 3", "gene_name": "Mfsd3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MHGKLLPLAGLYLVQGLPYGLQSSLLPILLRARGLSLTRVGLTKGLYAPWLLKLAWAPLVDRRGTPRVWLTFSTVCLGLVCGLLAVLPPPQAGQTGLPTTVMGLLLLLNLGAAVQDVALDTLAVQLLEPKELGPGNTVQVVAYKLGSALAGGGLLVFFPTLSWPLLFLLLTATYWLAAALAWAAPALGRLSRPQVSEHTPHTSYLLQDLLAVPGTLWTAGFVLTYKMGEQGAGSLFPLLLLDHGASASDLGLWSGLGAATCSIAGSSLGGALLARHCSHPRQPLKLLRSVLQLRLGGLACQTALLLHLNTPGASLDPGTVMRGAALLSLCLQQFLGGVVTTATFTVMMHCSQLAPRALQATHYSFLATLELLGKLLPGTLAGVLADGLGPRLCFAAFLVLSALPVLDLRLAPSNLT", "length": 416 }, "evidence": [ { "id": "45239683", "url": "http://www.informatics.jax.org/homology/45239683", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q96ES6-1", "protein_name": "Major facilitator superfamily domain-containing protein 3", "gene_name": "MFSD3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRGKLLPLAGLYLVQGLPYGLQSGLLPVLLRAGGLSLTRVGLAKVLYAPWLLKLAWAPLVDAQGSARAWVTRSTAGLGLVCGLLAGLPPPGAGQAGLPAAVAGLLLLLNLGAAMQDVALDALAVQLLEPAELGPGNTVQVVAYKLGAALAGGALLALLPTFSWPQLFLLLAATYWLAAALAWAAPALRRLPQQPPSEQRPHTAHLLRDVLAVPGTVWTAGFVLTYKLGEQGASSLFPLLLLDHGVSAPELGLWNGVGAVVCSIAGSSLGGTLLAKHWKLLPLLRSVLRFRLGGLACQTALVFHLDTLGASMDAGTILRGSALLSLCLQHFLGGLVTTVTFTGMMRCSQLAPRALQATHYSLLATLELLGKLLLGTLAGGLADGLGPHPCFLLLLILSAFPVLYLDLAPSTFL", "length": 412 }, "evidence": [ { "id": "45239683", "url": "http://www.informatics.jax.org/homology/45239683", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q5U419", "url": "https://www.uniprot.org/uniprot/Q5U419" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "transmembrane transporter activity", "id": "GO:0022857", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022857", "evidence": [ { "database": "UniProtKB", "id": "Q5U419", "url": "https://www.uniprot.org/uniprot/Q5U419" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 410, "end_pos": 412, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }