{ "uniprot_canonical_ac": "Q5U316-1", "uniprot_ac": "Q5U316", "uniprot_id": "RAB35_RAT", "mass": { "chemical_mass": 23025.0, "monoisotopic_mass": 23025.0 }, "refseq": { "ac": "NP_001013064", "name": "ras-related protein Rab-35", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013064" }, "gene_names": [ { "name": "Rab35", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5U316", "id": "Q5U316" }, { "name": "Rab35", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013064", "id": "NP_001013064" } ], "protein_names": [ { "name": "Ras-related protein Rab-35", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q5U316" }, { "name": "ras-related protein Rab-35", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013064", "id": "NP_001013064" } ], "function": [ { "annotation": "Rab35 colocalizes with actin filaments and with Cdc42, Rac1 and RhoA, and that Rab35 can activate Cdc42 both in vivo and in vitro", "evidence": [ { "database": "RefSeq", "id": "NP_001013064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013064" }, { "database": "PubMed", "id": "19289122", "url": "https://glygen.org/publication/PubMed/19289122" } ] }, { "annotation": "Rab35 is translocated from recycling endosomes to neurite tips in a late phase of NGF stimulation.", "evidence": [ { "database": "RefSeq", "id": "NP_001013064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013064" }, { "database": "PubMed", "id": "24852758", "url": "https://glygen.org/publication/PubMed/24852758" } ] }, { "annotation": "Rab35 regulates the formation of an EHD1-association site on Arf6-positive endosomes by integrating the functions of two distinct Rab35 effectors for successful neurite outgrowth.", "evidence": [ { "database": "RefSeq", "id": "NP_001013064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013064" }, { "database": "PubMed", "id": "23572513", "url": "https://glygen.org/publication/PubMed/23572513" } ] }, { "annotation": "Rab35/ACAP2 and cytohesin-2 antagonistically control oligodendrocyte differentiation and myelination through Arf6 regulation.", "evidence": [ { "database": "RefSeq", "id": "NP_001013064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013064" }, { "database": "PubMed", "id": "24600047", "url": "https://glygen.org/publication/PubMed/24600047" } ] }, { "annotation": "Showed by knockdown-rescue approaches that neither a centaurin-beta2 binding-deficient Rab35(T76S/T81A) mutant nor a Rab35 binding-deficient centaurin-beta2(N610A/N691A) mutant supported neurite outgrowth of PC12 cells", "evidence": [ { "database": "RefSeq", "id": "NP_001013064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013064" }, { "database": "PubMed", "id": "25694427", "url": "https://glygen.org/publication/PubMed/25694427" } ] }, { "annotation": "The findings of this study demonstrated that the Rab35/ESCRT pathway mediates the use-dependent degradation of a subset of Synaptic Vesicle membrane proteins in mammalian neurons.", "evidence": [ { "database": "RefSeq", "id": "NP_001013064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013064" }, { "database": "PubMed", "id": "27535913", "url": "https://glygen.org/publication/PubMed/27535913" } ] }, { "annotation": "The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in the process of endocytosis and is an essential rate-limiting regulator of the fast recycling pathway back to the plasma membrane. During cytokinesis, required for the postfurrowing terminal steps, namely for intercellular bridge stability and abscission, possibly by controlling phosphatidylinositol 4,5-bis phosphate (PIP2) and SEPT2 localization at the intercellular bridge. May indirectly regulate neurite outgrowth. Together with TBC1D13 may be involved in regulation of insulin-induced glucose transporter SLC2A4/GLUT4 translocation to the plasma membrane in adipocytes (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316#function" }, { "database": "UniProtKB", "id": "Q6PHN9", "url": "https://www.uniprot.org/uniprot/Q6PHN9#function" }, { "database": "UniProtKB", "id": "Q15286", "url": "https://www.uniprot.org/uniprot/Q15286#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "common_name": "Rat" } ], "gene": [ { "name": "Rab35", "url": "https://www.uniprot.org/uniprot/Q5U316", "locus": { "chromosome": "12", "start_pos": 40967103, "end_pos": 40991195, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000022014", "url": "https://www.ensembl.org/id/ENSRNOG00000022014" } ] } } ], "crossref": [ { "id": "ENSRNOG00000022014", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000022014", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd04110", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04110", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "288700", "url": "https://www.ncbi.nlm.nih.gov/gene/288700", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001806", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001806", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005225", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005225", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041815", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041815", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:288700", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:288700", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FMAITRQ", "url": "https://omabrowser.org/oma/group/FMAITRQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "8685at2759", "url": "http://www.orthodb.org/?query=8685at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR47977", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47977", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47977:SF76", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47977:SF76", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00071", "url": "http://pfam.xfam.org/family/PF00071", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q5U316", "url": "http://purl.obolibrary.org/obo/PR_Q5U316", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-8854214", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8854214", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8873719", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8873719", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8876198", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8876198", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001013064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013064", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1306362", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1306362", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I5ZT09", "url": "https://www.uniprot.org/uniprot/A0A8I5ZT09", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZT09-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZT09-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A0E0", "url": "https://www.uniprot.org/uniprot/A0A8I6A0E0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A0E0-1", "url": "https://www.uniprot.org/uniprot/A0A8I6A0E0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A5F7", "url": "https://www.uniprot.org/uniprot/A0A8I6A5F7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A5F7-1", "url": "https://www.uniprot.org/uniprot/A0A8I6A5F7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6ADQ8", "url": "https://www.uniprot.org/uniprot/A0A8I6ADQ8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6ADQ8-1", "url": "https://www.uniprot.org/uniprot/A0A8I6ADQ8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2QFM9", "url": "https://www.uniprot.org/uniprot/A0A8L2QFM9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2QFM9-1", "url": "https://www.uniprot.org/uniprot/A0A8L2QFM9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5U316-1", "url": "https://www.uniprot.org/uniprot/Q5U316-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC", "length": 201, "header": "sp|Q5U316-1|RAB35_RAT Isoform 1 of Ras-related protein Rab-35 OS=Rattus norvegicus OX=10116 GN=Rab35 PE=1 SV=1 CANONICAL=Q5U316-1" }, "isoforms": [ { "isoform_ac": "A0A8I5ZT09-1", "url": "", "sequence": { "sequence": "ILLEVYGKARIHSTSVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC", "length": 198, "header": "tr|A0A8I5ZT09-1|RAB35_RAT Computationally mapped isoform of Ras-related protein Rab-35 OS=Rattus norvegicus OX=10116 GN=Rab35 PE=1 SV=1 CANONICAL=Q5U316-1" }, "locus": { "chromosome": "12", "start_pos": 40982237, "end_pos": 40968484, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000113162.1", "url": "https://www.ensembl.org/id/ENSRNOT00000113162.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000081478.1", "url": "https://www.ensembl.org/id/ENSRNOP00000081478.1" } ] } }, { "isoform_ac": "A0A8I6A0E0-1", "url": "", "sequence": { "sequence": "MPSFSLLDIPGTCAPKHREGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC", "length": 203, "header": "tr|A0A8I6A0E0-1|RAB35_RAT Computationally mapped isoform of Ras-related protein Rab-35 OS=Rattus norvegicus OX=10116 GN=Rab35 PE=1 SV=1 CANONICAL=Q5U316-1" }, "locus": { "chromosome": "12", "start_pos": 40984665, "end_pos": 40968484, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000106644.1", "url": "https://www.ensembl.org/id/ENSRNOT00000106644.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000085013.1", "url": "https://www.ensembl.org/id/ENSRNOP00000085013.1" } ] } }, { "isoform_ac": "A0A8I6A5F7-1", "url": "", "sequence": { "sequence": "ARDYDHLFKLLIIGDSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC", "length": 183, "header": "tr|A0A8I6A5F7-1|RAB35_RAT Computationally mapped isoform of Ras-related protein Rab-35 OS=Rattus norvegicus OX=10116 GN=Rab35 PE=1 SV=1 CANONICAL=Q5U316-1" }, "locus": { "chromosome": "12", "start_pos": 40981076, "end_pos": 40968484, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000103324.1", "url": "https://www.ensembl.org/id/ENSRNOT00000103324.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000088611.1", "url": "https://www.ensembl.org/id/ENSRNOP00000088611.1" } ] } }, { "isoform_ac": "A0A8I6ADQ8-1", "url": "", "sequence": { "sequence": "MGSSGDLVPLKAFPLDIEWKKCGQEPWDRSLLLLCIGGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC", "length": 221, "header": "tr|A0A8I6ADQ8-1|RAB35_RAT Computationally mapped isoform of Ras-related protein Rab-35 OS=Rattus norvegicus OX=10116 GN=Rab35 PE=1 SV=1 CANONICAL=Q5U316-1" }, "locus": { "chromosome": "12", "start_pos": 40976831, "end_pos": 40968484, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000114049.1", "url": "https://www.ensembl.org/id/ENSRNOT00000114049.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000092476.1", "url": "https://www.ensembl.org/id/ENSRNOP00000092476.1" } ] } }, { "isoform_ac": "A0A8L2QFM9-1", "url": "", "sequence": { "sequence": "WGGAGRRVAAAPAAAAEEEEEEVGGAEGGVSVSSGCLFGKWIRRCRSSREGAADPEASTDPARPRARAAPARHGPGLRPPLQAAHHRRQRCGQEQLAVTICRQHLLSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC", "length": 272, "header": "tr|A0A8L2QFM9-1|A0A8L2QFM9_RAT Computationally mapped isoform of RAB35, member RAS oncogene family OS=Rattus norvegicus OX=10116 GN=Rab35 PE=1 SV=1 CANONICAL=Q5U316-1" }, "locus": { "chromosome": "12", "start_pos": 40981296, "end_pos": 40968484, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000030031.5", "url": "https://www.ensembl.org/id/ENSRNOT00000030031.5" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000029070.5", "url": "https://www.ensembl.org/id/ENSRNOP00000029070.5" } ] } }, { "isoform_ac": "Q5U316-1", "url": "", "sequence": { "sequence": "MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC", "length": 201, "header": "sp|Q5U316-1|RAB35_RAT Isoform 1 of Ras-related protein Rab-35 OS=Rattus norvegicus OX=10116 GN=Rab35 PE=1 SV=1 CANONICAL=Q5U316-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "site_lbl": "Thr72" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Rab35 regulates neurite outgrowth and cell shape.", "journal": "FEBS letters", "date": "2009", "authors": "Chevallier J, Koop C, Srivastava A, Petrie RJ, Lamarche-Vane N, Presley JF", "evidence": [ { "database": "RefSeq", "id": "NP_001013064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013064" } ], "reference": [ { "type": "PubMed", "id": "19289122", "url": "https://glygen.org/publication/PubMed/19289122" } ] }, { "title": "Rab35 establishes the EHD1-association site by coordinating two distinct effectors during neurite outgrowth.", "journal": "J. Cell Sci.", "date": "2013", "authors": "Kobayashi H, Fukuda M", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" }, { "database": "RefSeq", "id": "NP_001013064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013064" } ], "reference": [ { "type": "PubMed", "id": "23572513", "url": "https://glygen.org/publication/PubMed/23572513" } ] }, { "title": "Rab35, acting through ACAP2 switching off Arf6, negatively regulates oligodendrocyte differentiation and myelination.", "journal": "Molecular biology of the cell", "date": "2014", "authors": "Miyamoto Y, Yamamori N, Torii T, Tanoue A, Yamauchi J", "evidence": [ { "database": "RefSeq", "id": "NP_001013064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013064" } ], "reference": [ { "type": "PubMed", "id": "24600047", "url": "https://glygen.org/publication/PubMed/24600047" } ] }, { "title": "Rab35 is translocated from Arf6-positive perinuclear recycling endosomes to neurite tips during neurite outgrowth.", "journal": "Small GTPases", "date": "2014", "authors": "Kobayashi H, Etoh K, Fukuda M", "evidence": [ { "database": "RefSeq", "id": "NP_001013064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013064" } ], "reference": [ { "type": "PubMed", "id": "24852758", "url": "https://glygen.org/publication/PubMed/24852758" } ] }, { "title": "Structure-function analyses of the small GTPase Rab35 and its effector protein centaurin-beta2/ACAP2 during neurite outgrowth of PC12 cells.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Etoh K, Fukuda M", "evidence": [ { "database": "RefSeq", "id": "NP_001013064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013064" } ], "reference": [ { "type": "PubMed", "id": "25694427", "url": "https://glygen.org/publication/PubMed/25694427" } ] }, { "title": "Activity-Dependent Degradation of Synaptic Vesicle Proteins Requires Rab35 and the ESCRT Pathway.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2016", "authors": "Sheehan P, Zhu M, Beskow A, Vollmer C, Waites CL", "evidence": [ { "database": "RefSeq", "id": "NP_001013064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013064" } ], "reference": [ { "type": "PubMed", "id": "27535913", "url": "https://glygen.org/publication/PubMed/27535913" } ] } ], "pathway": [ { "id": "rno:288700", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:288700", "resource": "KEGG Pathway" }, { "id": "R-RNO-8854214", "name": "TBC/RABGAPs", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8854214", "resource": "Reactome", "description": "TBC/RABGAPs" }, { "id": "R-RNO-8873719", "name": "RAB geranylgeranylation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8873719", "resource": "Reactome", "description": "RAB geranylgeranylation" }, { "id": "R-RNO-8876198", "name": "RAB GEFs exchange GTP for GDP on RABs", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8876198", "resource": "Reactome", "description": "RAB GEFs exchange GTP for GDP on RABs" } ], "orthologs": [ { "uniprot_canonical_ac": "Q15286-1", "protein_name": "Ras-related protein Rab-35", "gene_name": "RAB35", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC", "length": 201 }, "evidence": [ { "id": "45230830", "url": "http://www.informatics.jax.org/homology/45230830", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q6PHN9-1", "protein_name": "Ras-related protein Rab-35", "gene_name": "Rab35", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC", "length": 201 }, "evidence": [ { "id": "45230830", "url": "http://www.informatics.jax.org/homology/45230830", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "GTPase activity", "id": "GO:0003924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003924", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "GTP binding", "id": "GO:0005525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005525", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "phosphatidylinositol-4,5-bisphosphate binding", "id": "GO:0005546", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005546", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "GDP binding", "id": "GO:0019003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019003", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "clathrin-coated pit", "id": "GO:0005905", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005905", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "melanosome", "id": "GO:0042470", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042470", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "intercellular bridge", "id": "GO:0045171", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045171", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "endosome membrane", "id": "GO:0010008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "synaptic vesicle membrane", "id": "GO:0030672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030672", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "clathrin-coated endocytic vesicle", "id": "GO:0045334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045334", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "cell projection membrane", "id": "GO:0031253", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031253", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "protein transport", "id": "GO:0015031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015031", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "neuron projection development", "id": "GO:0031175", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031175", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "cellular response to nerve growth factor stimulus", "id": "GO:1990090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990090", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "endosomal transport", "id": "GO:0016197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016197", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "protein localization to endosome", "id": "GO:0036010", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036010", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "mitotic cytokinesis", "id": "GO:0000281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000281", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "protein localization", "id": "GO:0008104", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008104", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "endocytic recycling", "id": "GO:0032456", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032456", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "Rab protein signal transduction", "id": "GO:0032482", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032482", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "antigen processing and presentation", "id": "GO:0019882", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019882", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" }, { "name": "plasma membrane to endosome transport", "id": "GO:0048227", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048227", "evidence": [ { "database": "UniProtKB", "id": "Q5U316", "url": "https://www.uniprot.org/uniprot/Q5U316" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }