{ "uniprot_canonical_ac": "Q5U2S1-1", "uniprot_ac": "Q5U2S1", "uniprot_id": "NFIP1_RAT", "mass": { "chemical_mass": 24913.0, "monoisotopic_mass": 24913.0 }, "refseq": { "ac": "NP_001013077", "name": "NEDD4 family-interacting protein 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013077" }, "gene_names": [ { "name": "Ndfip1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5U2S1", "id": "Q5U2S1" }, { "name": "N4wbp5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q5U2S1", "id": "Q5U2S1" }, { "name": "Ndfip1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013077", "id": "NP_001013077" } ], "protein_names": [ { "name": "NEDD4 family-interacting protein 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q5U2S1" }, { "name": "NEDD4 family-interacting protein 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013077", "id": "NP_001013077" } ], "function": [ { "annotation": "Activates HECT domain-containing E3 ubiquitin-protein ligases, including NEDD4 and ITCH, and consequently modulates the stability of their targets. As a result, controls many cellular processes. Prevents chronic T-helper cell-mediated inflammation by activating ITCH and thus controlling JUNB degradation. Promotes pancreatic beta cell death through degradation of JUNB and inhibition of the unfolded protein response, leading to reduction of insulin secretion. Restricts the production of pro-inflammatory cytokines in effector Th17 T-cells by promoting ITCH-mediated ubiquitination degradation of RORC. Together with NDFIP2, limits the cytokine signaling and expansion of effector Th2 T-cells by promoting degradation of JAK1, probably by ITCH- and NEDD4L-mediated ubiquitination. Regulates peripheral T-cell tolerance to self and foreign antigens, forcing the exit of naive CD4+ T-cells from the cell cycle before they become effector T-cells. Negatively regulates RLR-mediated antiviral response by promoting SMURF1-mediated ubiquitination and subsequent degradation of MAVS. Negatively regulates KCNH2 potassium channel activity by decreasing its cell-surface expression and interfering with channel maturation through recruitment of NEDD4L to the Golgi apparatus where it mediates KCNH2 degradation. In cortical neurons, mediates the ubiquitination of the divalent metal transporter SLC11A2/DMT1 by NEDD4L, leading to its down-regulation and protection of the cells from cobalt and iron toxicity. Important for normal development of dendrites and dendritic spines in cortex. Enhances the ubiquitination of BRAT1 mediated by: NEDD4, NEDD4L and ITCH and is required for the nuclear localization of ubiquitinated BRAT1. Enhances the ITCH-mediated ubiquitination of MAP3K7 by recruiting E2 ubiquitin-conjugating enzyme UBE2L3 to ITCH. Modulates EGFR signaling through multiple pathways. In particular, may regulate the ratio of AKT1-to-MAPK8 signaling in response to EGF, acting on AKT1 probably through PTEN destabilization and on MAPK8 through ITCH-dependent MAP2K4 inactivation. As a result, may control cell growth rate. Inhibits cell proliferation by promoting PTEN nuclear localization and changing its signaling specificity.", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1#function" }, { "database": "UniProtKB", "id": "Q8R0W6", "url": "https://www.uniprot.org/uniprot/Q8R0W6#function" }, { "database": "UniProtKB", "id": "Q9BT67", "url": "https://www.uniprot.org/uniprot/Q9BT67#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "common_name": "Rat" } ], "gene": [ { "name": "Ndfip1", "url": "https://www.uniprot.org/uniprot/Q5U2S1", "locus": { "chromosome": "18", "start_pos": 30322311, "end_pos": 30250613, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000013562", "url": "https://www.ensembl.org/id/ENSRNOG00000013562" } ] } } ], "crossref": [ { "id": "ENSRNOG00000013562", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000013562", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd22305", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd22305", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "291609", "url": "https://www.ncbi.nlm.nih.gov/gene/291609", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR019325", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019325", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:291609", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:291609", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "IPMQMQV", "url": "https://omabrowser.org/oma/group/IPMQMQV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4642592at2759", "url": "http://www.orthodb.org/?query=4642592at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13396", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13396", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13396:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13396:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF10176", "url": "http://pfam.xfam.org/family/PF10176", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q5U2S1", "url": "http://purl.obolibrary.org/obo/PR_Q5U2S1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001013077", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013077", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1310053", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1310053", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I5ZKG6", "url": "https://www.uniprot.org/uniprot/A0A8I5ZKG6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZKG6-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZKG6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A943", "url": "https://www.uniprot.org/uniprot/A0A8I6A943", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A943-1", "url": "https://www.uniprot.org/uniprot/A0A8I6A943-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AJ70", "url": "https://www.uniprot.org/uniprot/A0A8I6AJ70", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AJ70-1", "url": "https://www.uniprot.org/uniprot/A0A8I6AJ70-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6ANN8", "url": "https://www.uniprot.org/uniprot/A0A8I6ANN8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6ANN8-1", "url": "https://www.uniprot.org/uniprot/A0A8I6ANN8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5U2S1-1", "url": "https://www.uniprot.org/uniprot/Q5U2S1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALALAALAAVEPACGTGYQQLQNEEEPGEREQTAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY", "length": 221, "header": "sp|Q5U2S1-1|NFIP1_RAT Isoform 1 of NEDD4 family-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Ndfip1 PE=2 SV=1 CANONICAL=Q5U2S1-1" }, "isoforms": [ { "isoform_ac": "A0A8I5ZKG6-1", "url": "", "sequence": { "sequence": "KRFVLISDVFTQLQNEEEPGEREQTAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY", "length": 212, "header": "tr|A0A8I5ZKG6-1|NFIP1_RAT Computationally mapped isoform of NEDD4 family-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Ndfip1 PE=2 SV=1 CANONICAL=Q5U2S1-1" }, "locus": { "chromosome": "18", "start_pos": 30310835, "end_pos": 30291465, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000096236.1", "url": "https://www.ensembl.org/id/ENSRNOT00000096236.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000078162.1", "url": "https://www.ensembl.org/id/ENSRNOP00000078162.1" } ] } }, { "isoform_ac": "A0A8I6A943-1", "url": "", "sequence": { "sequence": "CQAAFQIGQNSSFRFASLQFVLISDVFTQLQNEEEPGEREQTAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY", "length": 229, "header": "tr|A0A8I6A943-1|A0A8I6A943_RAT Computationally mapped isoform of Nedd4 family interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Ndfip1 PE=4 SV=1 CANONICAL=Q5U2S1-1" }, "locus": { "chromosome": "18", "start_pos": 30310835, "end_pos": 30292322, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000097966.1", "url": "https://www.ensembl.org/id/ENSRNOT00000097966.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000087620.1", "url": "https://www.ensembl.org/id/ENSRNOP00000087620.1" } ] } }, { "isoform_ac": "A0A8I6AJ70-1", "url": "", "sequence": { "sequence": "MLPEMRIYQTSETLQNEEEPGEREQTAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY", "length": 213, "header": "tr|A0A8I6AJ70-1|A0A8I6AJ70_RAT Computationally mapped isoform of Nedd4 family interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Ndfip1 PE=4 SV=1 CANONICAL=Q5U2S1-1" }, "locus": { "chromosome": "18", "start_pos": 30310835, "end_pos": 30250613, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000104237.1", "url": "https://www.ensembl.org/id/ENSRNOT00000104237.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000093040.1", "url": "https://www.ensembl.org/id/ENSRNOP00000093040.1" } ] } }, { "isoform_ac": "A0A8I6ANN8-1", "url": "", "sequence": { "sequence": "MALALAALAAVEPACGTGYQQLQNEEEPGEREQTAGDAPPPYSSISAETYFDYKDESGFPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRRIYQLCKSSEDARNFLKSPQDQSSLYLLKMSSGKASCTDEVPREARAPAGSESPPGWRNSHLL", "length": 226, "header": "tr|A0A8I6ANN8-1|NFIP1_RAT Computationally mapped isoform of NEDD4 family-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Ndfip1 PE=2 SV=1 CANONICAL=Q5U2S1-1" }, "locus": { "chromosome": "18", "start_pos": 30315250, "end_pos": 30266007, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000107021.1", "url": "https://www.ensembl.org/id/ENSRNOT00000107021.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000095556.1", "url": "https://www.ensembl.org/id/ENSRNOP00000095556.1" } ] } }, { "isoform_ac": "Q5U2S1-1", "url": "", "sequence": { "sequence": "MALALAALAAVEPACGTGYQQLQNEEEPGEREQTAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY", "length": 221, "header": "sp|Q5U2S1-1|NFIP1_RAT Isoform 1 of NEDD4 family-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Ndfip1 PE=2 SV=1 CANONICAL=Q5U2S1-1" }, "locus": { "chromosome": "18", "start_pos": 30310835, "end_pos": 30266007, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000018499", "url": "https://www.ensembl.org/id/ENSRNOT00000018499" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000018499", "url": "https://www.ensembl.org/id/ENSRNOP00000018499" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Ndfip1 is required for the development of pyramidal neuron dendrites and spines in the neocortex.", "journal": "Cereb. Cortex", "date": "2014", "authors": "Goh C.P., Low L.H., Putz U., Tan S.S., Britto J.M., Gunnersen J.M., Hammond V.E., Howitt J.A., Hyakumura T., Tang M.M.", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "reference": [ { "type": "PubMed", "id": "23897647", "url": "https://glygen.org/publication/PubMed/23897647" } ] } ], "pathway": [ { "id": "rno:291609", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:291609", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8R0W6-1", "protein_name": "NEDD4 family-interacting protein 1", "gene_name": "Ndfip1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MALALAALAAVEPACGSGYQQLQNEEEPGEPEQTAGDAPPPYSSITAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKTEATIPLVPGRDEDFVGRDDFDDTDQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY", "length": 221 }, "evidence": [ { "id": "45237549", "url": "http://www.informatics.jax.org/homology/45237549", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9BT67-1", "protein_name": "NEDD4 family-interacting protein 1", "gene_name": "NDFIP1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY", "length": 221 }, "evidence": [ { "id": "45237549", "url": "http://www.informatics.jax.org/homology/45237549", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 19, "go_terms": [ { "name": "vacuolar transport", "id": "GO:0007034", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007034", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "metal ion transport", "id": "GO:0030001", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030001", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "negative regulation of transporter activity", "id": "GO:0032410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032410", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "regulation of isotype switching to IgG isotypes", "id": "GO:0048302", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048302", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "intracellular iron ion homeostasis", "id": "GO:0006879", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006879", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "negative regulation of inflammatory response", "id": "GO:0050728", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050728", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "positive regulation of protein ubiquitination", "id": "GO:0031398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031398", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "positive regulation of protein catabolic process", "id": "GO:0045732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045732", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "ubiquitin-dependent protein catabolic process", "id": "GO:0006511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006511", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "protein catabolic process", "id": "GO:0030163", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030163", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "negative regulation of type 2 immune response", "id": "GO:0002829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002829", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "negative regulation of CD4-positive, alpha-beta T cell proliferation", "id": "GO:2000562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000562", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "negative regulation of interleukin-4 production", "id": "GO:0032713", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032713", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "negative regulation of isotype switching to IgE isotypes", "id": "GO:0048294", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048294", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "CD4-positive, alpha-beta T cell proliferation", "id": "GO:0035739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035739", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "regulation of myeloid leukocyte differentiation", "id": "GO:0002761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002761", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "negative regulation of protein transport", "id": "GO:0051224", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051224", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "regulation of lymphocyte differentiation", "id": "GO:0045619", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045619", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "endosome membrane", "id": "GO:0010008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "cell cortex", "id": "GO:0005938", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005938", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "WW domain binding", "id": "GO:0050699", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050699", "evidence": [ { "database": "UniProtKB", "id": "Q5U2S1", "url": "https://www.uniprot.org/uniprot/Q5U2S1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }