{ "uniprot_canonical_ac": "Q5PR00-1", "uniprot_ac": "Q5PR00", "uniprot_id": "DJC22_RAT", "mass": { "chemical_mass": 38243.0, "monoisotopic_mass": 38243.0 }, "refseq": { "ac": "NP_001014226", "name": "dnaJ homolog subfamily C member 22", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001014226" }, "gene_names": [ { "name": "Dnajc22", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5PR00", "id": "Q5PR00" }, { "name": "Dnajc22", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001014226", "id": "NP_001014226" }, { "name": "RGD1311098", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001014226", "id": "NP_001014226" } ], "protein_names": [ { "name": "DnaJ homolog subfamily C member 22", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q5PR00" }, { "name": "DnaJ (Hsp40) homolog, subfamily C, member 22", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001014226", "id": "NP_001014226" }, { "name": "dnaJ homolog subfamily C member 22", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001014226", "id": "NP_001014226" } ], "function": [ { "annotation": "May function as a co-chaperone.", "evidence": [ { "database": "UniProtKB", "id": "Q5PR00", "url": "https://www.uniprot.org/uniprot/Q5PR00#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q5PR00", "url": "https://www.uniprot.org/uniprot/Q5PR00" } ], "common_name": "Rat" } ], "gene": [ { "name": "Dnajc22", "url": "https://www.uniprot.org/uniprot/Q5PR00", "locus": { "chromosome": "7", "start_pos": 130263230, "end_pos": 130257851, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000053498", "url": "https://www.ensembl.org/id/ENSRNOG00000053498" } ] } } ], "crossref": [ { "id": "ENSRNOG00000053498", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000053498", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd06257", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06257", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "362998", "url": "https://www.ncbi.nlm.nih.gov/gene/362998", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001623", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001623", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007829", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007829", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036869", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036869", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:362998", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:362998", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "VWWHCLL", "url": "https://omabrowser.org/oma/group/VWWHCLL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "10644at2759", "url": "http://www.orthodb.org/?query=10644at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR44733", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR44733", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR44733:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR44733:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00226", "url": "http://pfam.xfam.org/family/PF00226", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF05154", "url": "http://pfam.xfam.org/family/PF05154", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q5PR00", "url": "http://purl.obolibrary.org/obo/PR_Q5PR00", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001014226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001014226", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1311098", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1311098", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "Q5PR00", "url": "https://www.uniprot.org/uniprot/Q5PR00", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5PR00-1", "url": "https://www.uniprot.org/uniprot/Q5PR00-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAKGLLMTYALWAFGGPVGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWKLPSFVAQANGVQSWKQRPEEERPPLSLLRFASQMVVGVYFGLVALISLSSTANFYIVGLPLAVGLGVLLVAAVGNQTSDFKNTLGAAFLTSPVFYGRPIAILPISLAASITAQKHRRYKVSAVSETLSVRLYRVGLAYLAFTGPLAYSTLYNTAATINYAAETLGSFLSWFNFFPLLGRLVESVLLLPCRIWWLLVGAPGFNSSQFQEWEKLYEFVDSFQDEKRQLAHQVLGIPEGATNEEIHRSYRDLVKVWHPDHNRHQTEEAQRHFLEIQAAYEVLSQPKKPRASWR", "length": 341, "header": "sp|Q5PR00-1|DJC22_RAT Isoform 1 of DnaJ homolog subfamily C member 22 OS=Rattus norvegicus OX=10116 GN=Dnajc22 PE=2 SV=1 CANONICAL=Q5PR00-1" }, "isoforms": [ { "isoform_ac": "Q5PR00-1", "url": "", "sequence": { "sequence": "MAKGLLMTYALWAFGGPVGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWKLPSFVAQANGVQSWKQRPEEERPPLSLLRFASQMVVGVYFGLVALISLSSTANFYIVGLPLAVGLGVLLVAAVGNQTSDFKNTLGAAFLTSPVFYGRPIAILPISLAASITAQKHRRYKVSAVSETLSVRLYRVGLAYLAFTGPLAYSTLYNTAATINYAAETLGSFLSWFNFFPLLGRLVESVLLLPCRIWWLLVGAPGFNSSQFQEWEKLYEFVDSFQDEKRQLAHQVLGIPEGATNEEIHRSYRDLVKVWHPDHNRHQTEEAQRHFLEIQAAYEVLSQPKKPRASWR", "length": 341, "header": "sp|Q5PR00-1|DJC22_RAT Isoform 1 of DnaJ homolog subfamily C member 22 OS=Rattus norvegicus OX=10116 GN=Dnajc22 PE=2 SV=1 CANONICAL=Q5PR00-1" }, "locus": { "chromosome": "7", "start_pos": 130262721, "end_pos": 130259398, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000087932", "url": "https://www.ensembl.org/id/ENSRNOT00000087932" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000073678", "url": "https://www.ensembl.org/id/ENSRNOP00000073678" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:362998", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:362998", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8CHS2-1", "protein_name": "DnaJ homolog subfamily C member 22", "gene_name": "Dnajc22", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAKGLLMTYVLWALGGPVGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWKLPSFVAQANRVQSWKQRPEEERPPLSLLRFASQIVVGVYFGLVALVSLSSMDNFYIVGLPLAVGLGVLLVAAVGNQTSDFKNTLGAAFLTSPVFYGRPIAILPISLAASITAQKHRRYKASAGSETLSVRLYRVGLAYLAFTGPLAYSTMYNTAATINYVAETLGSFLSWFSFFPLLGRLVESVLLLPCRIWWLLVGGPGFNSSRFQEWEKLYEFVDSFQDEKLQLAHQVLGVPEGATNEEIHRSYRDLVKVWHPDHNRHQTEEAQRHFLEIQAAYEVLSQPKKPRAS", "length": 339 }, "evidence": [ { "id": "45234827", "url": "http://www.informatics.jax.org/homology/45234827", "database": "MGI" }, { "id": "Q5PR00", "url": "https://omabrowser.org/oma/group/Q5PR00/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8N4W6-1", "protein_name": "DnaJ homolog subfamily C member 22", "gene_name": "DNAJC22", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAKGLLVTYALWAVGGPAGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWKLPSFVAQANRAQGQRQSPRGVTPPLSPIRFAAQVIVGIYFGLVALISLSSMVNFYIVALPLAVGLGVLLVAAVGNQTSDFKNTLGSAFLTSPIFYGRPIAILPISVAASITAQRHRRYKALVASEPLSVRLYRLGLAYLAFTGPLAYSALCNTAATLSYVAETFGSFLNWFSFFPLLGRLMEFVLLLPYRIWRLLMGETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKPWGSRR", "length": 341 }, "evidence": [ { "id": "45234827", "url": "http://www.informatics.jax.org/homology/45234827", "database": "MGI" }, { "id": "Q5PR00", "url": "https://omabrowser.org/oma/group/Q5PR00/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q5PR00", "url": "https://www.uniprot.org/uniprot/Q5PR00" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 126, "end_pos": 128, "annotation": "n_glycosylation_sequon" }, { "start_pos": 253, "end_pos": 255, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }