{ "uniprot_canonical_ac": "Q5PPJ4-1", "uniprot_ac": "Q5PPJ4", "uniprot_id": "DOHH_RAT", "mass": { "chemical_mass": 33077.0, "monoisotopic_mass": 33077.0 }, "refseq": { "ac": "XP_006240999", "name": "deoxyhypusine hydroxylase isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006240999" }, "gene_names": [ { "name": "Dohh", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5PPJ4", "id": "Q5PPJ4" }, { "name": "DOHH", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q5PPJ4", "id": "Q5PPJ4" }, { "name": "Dohh", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006240999", "id": "XP_006240999" }, { "name": "RGD1304783", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006240999", "id": "XP_006240999" } ], "protein_names": [ { "name": "Deoxyhypusine hydroxylase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q5PPJ4" }, { "name": "1.14.99.29", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5PPJ4" }, { "name": "DOHH", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5PPJ4" }, { "name": "Deoxyhypusine dioxygenase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5PPJ4" }, { "name": "Deoxyhypusine monooxygenase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5PPJ4" }, { "name": "deoxyhypusine hydroxylase isoform X1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006240999", "id": "XP_006240999" } ], "function": [ { "annotation": "Catalyzes the hydroxylation of the N(6)-(4-aminobutyl)-L-lysine intermediate produced by deoxyhypusine synthase/DHPS on a critical lysine of the eukaryotic translation initiation factor 5A/eIF-5A. This is the second step of the post-translational modification of that lysine into an unusual amino acid residue named hypusine. Hypusination is unique to mature eIF-5A factor and is essential for its function.", "evidence": [ { "database": "UniProtKB", "id": "Q5PPJ4", "url": "https://www.uniprot.org/uniprot/Q5PPJ4#function" }, { "database": "UniProtKB", "id": "MF_03101", "url": "https://www.uniprot.org/uniprot/MF_03101#function" }, { "database": "UniProtKB", "id": "Q99LN9", "url": "https://www.uniprot.org/uniprot/Q99LN9#function" } ] }, { "annotation": "Catalyzes the hydroxylation of the N(6)-(4-aminobutyl)-L-lysine intermediate to form hypusine, an essential post-translational modification only found in mature eIF-5A factor.", "evidence": [ { "database": "UniProtKB", "id": "A0A8L2Q272", "url": "https://www.uniprot.org/uniprot/A0A8L2Q272#function" }, { "database": "UniProtKB", "id": "MF_03101", "url": "https://www.uniprot.org/uniprot/MF_03101#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q5PPJ4", "url": "https://www.uniprot.org/uniprot/Q5PPJ4" } ], "common_name": "Rat" } ], "gene": [ { "name": "Dohh", "url": "https://www.uniprot.org/uniprot/Q5PPJ4", "locus": { "chromosome": "7", "start_pos": 8321466, "end_pos": 8326289, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000004259", "url": "https://www.ensembl.org/id/ENSRNOG00000004259" } ] } } ], "crossref": [ { "id": "ENSRNOG00000004259", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000004259", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "314644", "url": "https://www.ncbi.nlm.nih.gov/gene/314644", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR004155", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004155", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011989", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011989", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016024", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016024", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027517", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027517", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:314644", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:314644", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "GQLQEPC", "url": "https://omabrowser.org/oma/group/GQLQEPC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5474306at2759", "url": "http://www.orthodb.org/?query=5474306at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12697", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12697", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12697:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12697:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13646", "url": "http://pfam.xfam.org/family/PF13646", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q5PPJ4", "url": "http://purl.obolibrary.org/obo/PR_Q5PPJ4", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-204626", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-204626", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_006240999", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_006240999", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1304783", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1304783", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "14101", "url": "https://www.rhea-db.org/rhea/14101", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A8I6ANT1", "url": "https://www.uniprot.org/uniprot/A0A8I6ANT1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6ANT1-1", "url": "https://www.uniprot.org/uniprot/A0A8I6ANT1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2Q272", "url": "https://www.uniprot.org/uniprot/A0A8L2Q272", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2Q272-1", "url": "https://www.uniprot.org/uniprot/A0A8L2Q272-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5PPJ4", "url": "https://www.uniprot.org/uniprot/Q5PPJ4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5PPJ4-1", "url": "https://www.uniprot.org/uniprot/Q5PPJ4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVTEQEVEAIGKTLVDSTQPLQARFRALFTLRGLGGPDAISWISRGFEDSSALLKHELAYCLGQMRDPRAIPVLVSVLQDRNQEPMVRHEAGEALGAIGNPKVLGLLKQYSTDPVVEVAETCQLAVRRLEWLQQHPGEATCAGPYLSVDPAPPAAEGDVGRLRETLLDEAQPLFERYRAMFALRNVGGKEAALALAEGLKCGSALFRHEVGYVLGQLQHEAAVSELAATLARTTESPMVRHECAEALGAIARPACLAALREYITDPERVVRESCEVALDMYEYENGQDFQYADGLERLRPPP", "length": 302, "header": "sp|Q5PPJ4-1|DOHH_RAT Isoform 1 of Deoxyhypusine hydroxylase OS=Rattus norvegicus OX=10116 GN=Dohh PE=2 SV=1 CANONICAL=Q5PPJ4-1" }, "isoforms": [ { "isoform_ac": "A0A8I6ANT1-1", "url": "", "sequence": { "sequence": "MVTEQEVEAIGKTLVDSTQPLQARFRALFTLRGLGGPDAISWISRGFEDSSALLKHELAYCLGQMRDPRAIPVLVSVLQDRNQEPMVRHEAGEALGAIGNPKVLGLLKQYSTDPVVEVAETCQLAVRRLEWLQQHPGEATCAGPYLSVDPAPPAAEGDVGRLRETLLDEAQPLFERYRAMFALRNVGGKEAALALAEGEVEPPQTWVVSCAA", "length": 212, "header": "tr|A0A8I6ANT1-1|A0A8I6ANT1_RAT Computationally mapped isoform of Deoxyhypusine hydroxylase OS=Rattus norvegicus OX=10116 GN=Dohh PE=1 SV=1 CANONICAL=Q5PPJ4-1" }, "locus": { "chromosome": "7", "start_pos": 8324049, "end_pos": 8322411, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000104214.1", "url": "https://www.ensembl.org/id/ENSRNOT00000104214.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000095710.1", "url": "https://www.ensembl.org/id/ENSRNOP00000095710.1" } ] } }, { "isoform_ac": "A0A8L2Q272-1", "url": "", "sequence": { "sequence": "MPLQARFRALFTLRGLGGPDAISWISRGFEDSSALLKHELAYCLGQMRDPRAIPVLVSVLQDRNQEPMVRHEAGEALGAIGNPKVLGLLKQYSTDPVVEVAETCQLAVRRLEWLQQHPGEATCAGPYLSVDPAPPAAEGDVGRLRETLLDEAQPLFERYRAMFALRNVGGKEAALALAEGLKCGSALFRHEVGYVLGQLQHEAAVSELAATLARTTESPMVRHECAEALGAIARPACLAALREYITDPERVVRESCEVALDMYEYENGQDFQYADGLERLRPPP", "length": 284, "header": "tr|A0A8L2Q272-1|A0A8L2Q272_RAT Computationally mapped isoform of Deoxyhypusine hydroxylase OS=Rattus norvegicus OX=10116 GN=Dohh PE=1 SV=1 CANONICAL=Q5PPJ4-1" }, "locus": { "chromosome": "7", "start_pos": 8324049, "end_pos": 8321959, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000005640.7", "url": "https://www.ensembl.org/id/ENSRNOT00000005640.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000005640.4", "url": "https://www.ensembl.org/id/ENSRNOP00000005640.4" } ] } }, { "isoform_ac": "Q5PPJ4-1", "url": "", "sequence": { "sequence": "MVTEQEVEAIGKTLVDSTQPLQARFRALFTLRGLGGPDAISWISRGFEDSSALLKHELAYCLGQMRDPRAIPVLVSVLQDRNQEPMVRHEAGEALGAIGNPKVLGLLKQYSTDPVVEVAETCQLAVRRLEWLQQHPGEATCAGPYLSVDPAPPAAEGDVGRLRETLLDEAQPLFERYRAMFALRNVGGKEAALALAEGLKCGSALFRHEVGYVLGQLQHEAAVSELAATLARTTESPMVRHECAEALGAIARPACLAALREYITDPERVVRESCEVALDMYEYENGQDFQYADGLERLRPPP", "length": 302, "header": "sp|Q5PPJ4-1|DOHH_RAT Isoform 1 of Deoxyhypusine hydroxylase OS=Rattus norvegicus OX=10116 GN=Dohh PE=2 SV=1 CANONICAL=Q5PPJ4-1" }, "locus": { "chromosome": "7", "start_pos": 8324049, "end_pos": 8321959, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000112038", "url": "https://www.ensembl.org/id/ENSRNOT00000112038" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000093565", "url": "https://www.ensembl.org/id/ENSRNOP00000093565" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "rno:314644", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:314644", "resource": "KEGG Pathway" }, { "id": "R-RNO-204626", "name": "Hypusine synthesis from eIF5A-lysine", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-204626", "resource": "Reactome", "description": "Hypusine synthesis from eIF5A-lysine" } ], "orthologs": [ { "uniprot_canonical_ac": "P47120-1", "protein_name": "Deoxyhypusine hydroxylase", "gene_name": "LIA1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MSTNFEKHFQENVDECTLEQLRDILVNKSGKTVLANRFRALFNLKTVAEEFATKPEEAKKAIEYIAESFVNDKSELLKHEVAYVLGQTKNLDAAPTLRHVMLDQNQEPMVRHEAAEALGALGDKDSLDDLNKAAKEDPHVAVRETCELAINRINWTHGGAKDKENLQQSLYSSIDPAPPLPLEKDATIPELQALLNDPKQPLFQRYRAMFRLRDIGTDEAILALATGFSAESSLFKHEIAYVFGQIGSPAAVPSLIEVLGRKEEAPMVRHEAAEALGAIASPEVVDVLKSYLNDEVDVVRESCIVALDMYDYENSNELEYAPTAN", "length": 325 }, "evidence": [ { "id": "Q5PPJ4", "url": "https://omabrowser.org/oma/group/Q5PPJ4/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q99LN9-1", "protein_name": "Deoxyhypusine hydroxylase", "gene_name": "Dohh", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVTEQEIEAIGKTLVDPKQPLQARFRALFTLRGLGGPDAISWISRGFEDSSALLKHELAYCLGQMRDARAIPVLADVLQDTSQEPMVRHEAGEALGAIGNPEVLGLLKQYSTDPVVEVAETCQLAVGRLEWLQQHPGEATCAGPYLSVDPAPPAAEQDVGRLREALLDEARPLFERYRAMFALRNVGGKEAALALAEGLQCGSALFRHEVGYVLGQLQHEAAVPGLAATLARTTESPMVRHECAEALGAIARPACLAALREHIEDPEQVVRESCEVALDMYEYESSQDFQYADGLERLRPPP", "length": 302 }, "evidence": [ { "id": "45236623", "url": "http://www.informatics.jax.org/homology/45236623", "database": "MGI" }, { "id": "Q5PPJ4", "url": "https://omabrowser.org/oma/group/Q5PPJ4/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9BU89-1", "protein_name": "Deoxyhypusine hydroxylase", "gene_name": "DOHH", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVTEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGEPAAGPYLSVDPAPPAEERDVGRLREALLDESRPLFERYRAMFALRNAGGEEAALALAEGLHCGSALFRHEVGYVLGQLQHEAAVPQLAAALARCTENPMVRHECAEALGAIARPACLAALQAHADDPERVVRESCEVALDMYEHETGRAFQYADGLEQLRGAPS", "length": 302 }, "evidence": [ { "id": "Q5PPJ4", "url": "https://omabrowser.org/oma/group/Q5PPJ4/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9V9U4-1", "protein_name": "Deoxyhypusine hydroxylase", "gene_name": "nero", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MVSQQQIEAIGGVLNNKERPLKERFRALFTLKNIGGGAAIEAISKAFDDDSALLKHELAYCLGQMQDAQALDILTKVLKDTTQEPMVRHEAAEAMGAIGHPDVLPILEEYKQDPVVEVAETCAIALDRVRWLQSGQKVDDSNPYASVDPSPPTAGDKSVTELKAIYLDAQQSLFDRYRAMFSLRNLRTEESVLAIAEGLKDSSALFRHEVAFVLGQLQEPCSIPFLQENLEDRLENEMVRHECAEALGAIATEDCIQILNRYAEDDKRVVKESCVIALDMCEYENSPEFQYADGLAKLDATK", "length": 302 }, "evidence": [ { "id": "Q5PPJ4", "url": "https://omabrowser.org/oma/group/Q5PPJ4/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "deoxyhypusine monooxygenase activity", "id": "GO:0019135", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019135", "evidence": [ { "database": "UniProtKB", "id": "Q5PPJ4", "url": "https://www.uniprot.org/uniprot/Q5PPJ4" } ], "pmid": "" }, { "name": "iron ion binding", "id": "GO:0005506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005506", "evidence": [ { "database": "UniProtKB", "id": "Q5PPJ4", "url": "https://www.uniprot.org/uniprot/Q5PPJ4" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q5PPJ4", "url": "https://www.uniprot.org/uniprot/Q5PPJ4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "peptidyl-lysine modification to peptidyl-hypusine", "id": "GO:0008612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008612", "evidence": [ { "database": "UniProtKB", "id": "Q5PPJ4", "url": "https://www.uniprot.org/uniprot/Q5PPJ4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "14101", "name": "", "equation": "[eIF5A protein]-deoxyhypusine + AH2 + O2 = [eIF5A protein]-hypusine + A + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5PPJ4-1", "Q9BU89-1", "Q99LN9-1", "P47120-1", "Q556G4-1", "Q9V9U4-1" ], "evidence": [ { "id": "14101", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/14101" } ] }, { "id": "R-RNO-204662", "name": "DOHH:Fe2+ hydroxylates Dhp-K50-EIF5A to form Hyp-K50-EIF5A", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5PPJ4-1" ], "evidence": [ { "id": "R-RNO-204662", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-204662" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P47120", "gene_name": "LIA1", "activity": [ { "ec_number": "1.14.99.29", "activity": "[eIF5A protein]-deoxyhypusine + AH2 + O2 = [eIF5A protein]-hypusine + A + H2O.", "evidence": [ { "id": "P47120", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47120" } ] }, { "ec_number": "1.14.99.29", "activity": "", "evidence": [ { "id": "P47120", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47120" } ] } ] }, { "uniprot_ac": "Q556G4", "gene_name": "dohh-2", "activity": [ { "ec_number": "1.14.99.29", "activity": "[eIF5A protein]-deoxyhypusine + AH2 + O2 = [eIF5A protein]-hypusine + A + H2O.", "evidence": [ { "id": "Q556G4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556G4" } ] }, { "ec_number": "1.14.99.29", "activity": "", "evidence": [ { "id": "Q556G4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556G4" } ] } ] }, { "uniprot_ac": "Q5PPJ4", "gene_name": "Dohh", "activity": [ { "ec_number": "1.14.99.29", "activity": "[eIF5A protein]-deoxyhypusine + AH2 + O2 = [eIF5A protein]-hypusine + A + H2O.", "evidence": [ { "id": "Q5PPJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5PPJ4" } ] }, { "ec_number": "1.14.99.29", "activity": "", "evidence": [ { "id": "Q5PPJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5PPJ4" } ] } ] }, { "uniprot_ac": "Q99LN9", "gene_name": "Dohh", "activity": [ { "ec_number": "1.14.99.29", "activity": "[eIF5A protein]-deoxyhypusine + AH2 + O2 = [eIF5A protein]-hypusine + A + H2O.", "evidence": [ { "id": "Q99LN9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LN9" } ] }, { "ec_number": "1.14.99.29", "activity": "", "evidence": [ { "id": "Q99LN9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LN9" } ] } ] }, { "uniprot_ac": "Q9BU89", "gene_name": "DOHH", "activity": [ { "ec_number": "1.14.99.29", "activity": "[eIF5A protein]-deoxyhypusine + AH2 + O2 = [eIF5A protein]-hypusine + A + H2O.", "evidence": [ { "id": "Q9BU89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BU89" } ] }, { "ec_number": "1.14.99.29", "activity": "", "evidence": [ { "id": "Q9BU89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BU89" } ] } ] }, { "uniprot_ac": "Q9V9U4", "gene_name": "nero", "activity": [ { "ec_number": "1.14.99.29", "activity": "[eIF5A protein]-deoxyhypusine + AH2 + O2 = [eIF5A protein]-hypusine + A + H2O.", "evidence": [ { "id": "Q9V9U4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V9U4" } ] }, { "ec_number": "1.14.99.29", "activity": "", "evidence": [ { "id": "Q9V9U4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V9U4" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }