{ "uniprot_canonical_ac": "Q5M9G1-1", "uniprot_ac": "Q5M9G1", "uniprot_id": "HEXI1_RAT", "mass": { "chemical_mass": 40317.0, "monoisotopic_mass": 40317.0 }, "refseq": { "ac": "NP_001020307", "name": "protein HEXIM1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001020307" }, "gene_names": [ { "name": "Hexim1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5M9G1", "id": "Q5M9G1" }, { "name": "Clp-1; Clp1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001020307", "id": "NP_001020307" }, { "name": "Clp1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q5M9G1", "id": "Q5M9G1" }, { "name": "Hexim1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001020307", "id": "NP_001020307" } ], "protein_names": [ { "name": "Protein HEXIM1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q5M9G1" }, { "name": "Cardiac lineage protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5M9G1" }, { "name": "cardiac lineage protein 1; hexamethylene bis-acetamide inducible 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001020307", "id": "NP_001020307" }, { "name": "protein HEXIM1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001020307", "id": "NP_001020307" } ], "function": [ { "annotation": "Transcriptional regulator which functions as a general RNA polymerase II transcription inhibitor. Core component of the 7SK RNP complex: in cooperation with 7SK snRNA sequesters P-TEFb in a large inactive 7SK snRNP complex preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation. May also regulate NF-kappa-B, ESR1, NR3C1 and CIITA-dependent transcriptional activity. Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway.", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1#function" }, { "database": "UniProtKB", "id": "O94992", "url": "https://www.uniprot.org/uniprot/O94992#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "common_name": "Rat" } ], "gene": [ { "name": "Hexim1", "url": "https://www.uniprot.org/uniprot/Q5M9G1", "locus": { "chromosome": "10", "start_pos": 88066189, "end_pos": 88062803, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000003203", "url": "https://www.ensembl.org/id/ENSRNOG00000003203" } ] } } ], "crossref": [ { "id": "ENSRNOG00000003203", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000003203", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "498008", "url": "https://www.ncbi.nlm.nih.gov/gene/498008", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q5M9G1", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q5M9G1*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR024872", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024872", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:498008", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:498008", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "CHDSEAN", "url": "https://omabrowser.org/oma/group/CHDSEAN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2905032at2759", "url": "http://www.orthodb.org/?query=2905032at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13469", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13469", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13469:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13469:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15313", "url": "http://pfam.xfam.org/family/PF15313", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q5M9G1", "url": "http://purl.obolibrary.org/obo/PR_Q5M9G1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001020307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001020307", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1559851", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1559851", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5M9G1-1", "url": "https://www.uniprot.org/uniprot/Q5M9G1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAEPLLSEHQHQPQTSNCTGAAVVHEEQNSERPPSAEERVPKEDSRWQSRASLQSGSRPGQEGDGGLKHQLPPLQTNACPELSCLEKGEKGQNGEDLSTGGASPSAEGEPMSESLVQPGHDSEATKLEAPVAGVEEPWGQQQRQLGKKKHRRRPSKKKRHWKPYYKLTWEEKKKFDEKQSLRASRVRAEMFAKGQPVAPYNTTQFLMDDHDQEEPDLKTGLYPKRAAAKSDDTSDEDFVEEAGEEDGGSDGMGGDGSEFLQRDFSETYERYHAESLQNMSKQELIKEYLELEKCLSRKEDENNRLRLESKRLGGVDARVRELELELDRLRAENRQLLTENELHRQQERAPPSKFGD", "length": 356, "header": "sp|Q5M9G1-1|HEXI1_RAT Isoform 1 of Protein HEXIM1 OS=Rattus norvegicus OX=10116 GN=Hexim1 PE=1 SV=1 CANONICAL=Q5M9G1-1" }, "isoforms": [ { "isoform_ac": "Q5M9G1-1", "url": "", "sequence": { "sequence": "MAEPLLSEHQHQPQTSNCTGAAVVHEEQNSERPPSAEERVPKEDSRWQSRASLQSGSRPGQEGDGGLKHQLPPLQTNACPELSCLEKGEKGQNGEDLSTGGASPSAEGEPMSESLVQPGHDSEATKLEAPVAGVEEPWGQQQRQLGKKKHRRRPSKKKRHWKPYYKLTWEEKKKFDEKQSLRASRVRAEMFAKGQPVAPYNTTQFLMDDHDQEEPDLKTGLYPKRAAAKSDDTSDEDFVEEAGEEDGGSDGMGGDGSEFLQRDFSETYERYHAESLQNMSKQELIKEYLELEKCLSRKEDENNRLRLESKRLGGVDARVRELELELDRLRAENRQLLTENELHRQQERAPPSKFGD", "length": 356, "header": "sp|Q5M9G1-1|HEXI1_RAT Isoform 1 of Protein HEXIM1 OS=Rattus norvegicus OX=10116 GN=Hexim1 PE=1 SV=1 CANONICAL=Q5M9G1-1" }, "locus": { "chromosome": "10", "start_pos": 88064534, "end_pos": 88063467, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000004272", "url": "https://www.ensembl.org/id/ENSRNOT00000004272" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000004272", "url": "https://www.ensembl.org/id/ENSRNOP00000004272" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 103, "end_pos": 103, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "iPTMnet", "id": "Q5M9G1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5M9G1" } ], "site_lbl": "Ser103" }, { "start_pos": 230, "end_pos": 230, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "site_lbl": "Ser230" }, { "start_pos": 233, "end_pos": 233, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "site_lbl": "Thr233" }, { "start_pos": 234, "end_pos": 234, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "site_lbl": "Ser234" }, { "start_pos": 249, "end_pos": 249, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "iPTMnet", "id": "Q5M9G1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5M9G1" } ], "site_lbl": "Ser249" }, { "start_pos": 257, "end_pos": 257, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "site_lbl": "Ser257" }, { "start_pos": 98, "end_pos": 98, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "site_lbl": "Ser98" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Structure, expression, and functional characterization of the mouse CLP-1 gene.", "journal": "Gene", "date": "2002", "authors": "Huang F, Wagner M, Siddiqui MA", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "reference": [ { "type": "PubMed", "id": "12119119", "url": "https://glygen.org/publication/PubMed/12119119" } ] }, { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nature communications", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" }, { "database": "iPTMnet", "id": "Q5M9G1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5M9G1" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] } ], "pathway": [ { "id": "rno:498008", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:498008", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O94992-1", "protein_name": "Protein HEXIM1", "gene_name": "HEXIM1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAEPFLSEYQHQPQTSNCTGAAAVQEELNPERPPGAEERVPEEDSRWQSRAFPQLGGRPGPEGEGSLESQPPPLQTQACPESSCLREGEKGQNGDDSSAGGDFPPPAEVEPTPEAELLAQPCHDSEASKLGAPAAGGEEEWGQQQRQLGKKKHRRRPSKKKRHWKPYYKLTWEEKKKFDEKQSLRASRIRAEMFAKGQPVAPYNTTQFLMDDHDQEEPDLKTGLYSKRAAAKSDDTSDDDFMEEGGEEDGGSDGMGGDGSEFLQRDFSETYERYHTESLQNMSKQELIKEYLELEKCLSRMEDENNRLRLESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQERAPLSKFGD", "length": 359 }, "evidence": [ { "id": "45235783", "url": "http://www.informatics.jax.org/homology/45235783", "database": "MGI" }, { "id": "Q5M9G1", "url": "https://omabrowser.org/oma/group/Q5M9G1/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8R409-1", "protein_name": "Protein HEXIM1", "gene_name": "Hexim1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAEPLLTEHQHQPQTSNCTGAAVVHEEHTSERPPSAEERVPKEDSRWQSRASLQSGSRPGQEGEGGLKHQLPPLQTNACPELSSLEKGEKGQNGEDLSTGGASPSAEGEPMSESLVQPGHDSEATKQEAPAAGGEEPWGQQQRQLGKKKHRRRPSKKKRHWKPYYKLTWEEKKKFDEKQSLRASRVRAEMFAKGQPVAPYNTTQFLMDDHDQEEPDLKTGLYPKRAAAKSDDTSDEDFVEEAGEEDGGSDGMGGDGSEFLQRDFSETYERYHAESLQNMSKQELIKEYLELEKCLSRKEDENNRLRLESKRLGGVDARVRELELELDRLRAENLQLLTENELHRQQERAPLSKFGD", "length": 356 }, "evidence": [ { "id": "45235783", "url": "http://www.informatics.jax.org/homology/45235783", "database": "MGI" }, { "id": "Q5M9G1", "url": "https://omabrowser.org/oma/group/Q5M9G1/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "negative regulation of viral transcription", "id": "GO:0032897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032897", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "pmid": "" }, { "name": "heart development", "id": "GO:0007507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007507", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "pmid": "" }, { "name": "negative regulation of DNA-templated transcription", "id": "GO:0045892", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045892", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "pmid": "" }, { "name": "negative regulation of cyclin-dependent protein serine/threonine kinase activity", "id": "GO:0045736", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045736", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "pmid": "" }, { "name": "activation of innate immune response", "id": "GO:0002218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002218", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "pmid": "" }, { "name": "positive regulation of signal transduction by p53 class mediator", "id": "GO:1901798", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901798", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "pmid": "" }, { "name": "7SK snRNP", "id": "GO:0120259", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120259", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "pmid": "" }, { "name": "protein kinase inhibitor activity", "id": "GO:0004860", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004860", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "pmid": "" }, { "name": "snRNA binding", "id": "GO:0017069", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017069", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "pmid": "" }, { "name": "7SK snRNA binding", "id": "GO:0097322", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097322", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "pmid": "" }, { "name": "cyclin-dependent protein serine/threonine kinase inhibitor activity", "id": "GO:0004861", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004861", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "pmid": "" }, { "name": "P-TEFb complex binding", "id": "GO:0106140", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106140", "evidence": [ { "database": "UniProtKB", "id": "Q5M9G1", "url": "https://www.uniprot.org/uniprot/Q5M9G1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 17, "end_pos": 19, "annotation": "n_glycosylation_sequon" }, { "start_pos": 201, "end_pos": 203, "annotation": "n_glycosylation_sequon" }, { "start_pos": 278, "end_pos": 280, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }