{ "uniprot_canonical_ac": "Q5M880-1", "uniprot_ac": "Q5M880", "uniprot_id": "S66A2_RAT", "mass": { "chemical_mass": 30571.0, "monoisotopic_mass": 30571.0 }, "refseq": {}, "gene_names": [ { "name": "Slc66a2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5M880", "id": "Q5M880" }, { "name": "Pqlc1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q5M880", "id": "Q5M880" } ], "protein_names": [ { "name": "Solute carrier family 66 member 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q5M880" }, { "name": "PQ-loop repeat-containing protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5M880" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q5M880", "url": "https://www.uniprot.org/uniprot/Q5M880" } ], "common_name": "Rat" } ], "gene": [ { "name": "Slc66a2", "url": "https://www.uniprot.org/uniprot/Q5M880", "locus": { "chromosome": "18", "start_pos": 73739676, "end_pos": 73702564, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000059215", "url": "https://www.ensembl.org/id/ENSRNOG00000059215" } ] } } ], "crossref": [ { "id": "ENSRNOG00000059215", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000059215", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "361352", "url": "https://www.ncbi.nlm.nih.gov/gene/361352", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR006603", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006603", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:361352", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:361352", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FKMWFFF", "url": "https://omabrowser.org/oma/group/FKMWFFF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2947405at2759", "url": "http://www.orthodb.org/?query=2947405at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR14856", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14856", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14856:SF10", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14856:SF10", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04193", "url": "http://pfam.xfam.org/family/PF04193", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q5M880", "url": "http://purl.obolibrary.org/obo/PR_Q5M880", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001013207", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001013207", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1305223", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1305223", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I6AJV0", "url": "https://www.uniprot.org/uniprot/A0A8I6AJV0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AJV0-1", "url": "https://www.uniprot.org/uniprot/A0A8I6AJV0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2UR94", "url": "https://www.uniprot.org/uniprot/A0A8L2UR94", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2UR94-1", "url": "https://www.uniprot.org/uniprot/A0A8L2UR94-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5M880", "url": "https://www.uniprot.org/uniprot/Q5M880", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5M880-1", "url": "https://www.uniprot.org/uniprot/Q5M880-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5M880-2", "url": "https://www.uniprot.org/uniprot/Q5M880-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEAEGLGWLLVPLHQLVSWVAAGAMVFGGVVPYIPQYRDIRRTQNADGFSTHVCLVLLVANILRILFWFGRHFESPLLWQSIVMILTMLLMLKLCTEVRVANELNVKRRSFAATDSKDEELRVPPRRPYLDFDPHHFWHWSSFADYVQCVLAFTGVAGYITYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNYRHRSTEGMSLKMVLMWTSGDTFKTAYFLLNGAPLQFSVCGLLQVMVDLAILGQAYAFAHHPQKPAPHAVHPASAKAL", "length": 271, "header": "sp|Q5M880-1|S66A2_RAT Isoform 1 of Solute carrier family 66 member 2 OS=Rattus norvegicus OX=10116 GN=Slc66a2 PE=1 SV=2 CANONICAL=Q5M880-1" }, "isoforms": [ { "isoform_ac": "A0A8I6AJV0-1", "url": "", "sequence": { "sequence": "MEAEGLGWLLVPLHQLVSWVAAGAMVFGGVVPYIPQYRDIRRTQNADGFSTHVCLVLLVANILRILFWFGRHFESPLLWQSIVMILTMLLMLKLCTEVRVANELNVKRRSFAATDSKDEELRVPPRRPYLGMYY", "length": 134, "header": "tr|A0A8I6AJV0-1|S66A2_RAT Computationally mapped isoform of Solute carrier family 66 member 2 OS=Rattus norvegicus OX=10116 GN=Slc66a2 PE=1 SV=1 CANONICAL=Q5M880-1" }, "locus": { "chromosome": "18", "start_pos": 73719392, "end_pos": 73704116, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000112225.1", "url": "https://www.ensembl.org/id/ENSRNOT00000112225.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000093969.1", "url": "https://www.ensembl.org/id/ENSRNOP00000093969.1" } ] } }, { "isoform_ac": "A0A8L2UR94-1", "url": "", "sequence": { "sequence": "MEAEGLGWLLVPLHQLVSWVAAGAMVFGGVVPYIPQYRDIRRTQNADGFSTHVCLVLLVANILRILFWFGRHFESPLLWQSIVMILTMLLMLKLCTEVRVANELNVKRRSFADFDPHHFWHWSSFADYVQCVLAFTGVAGYITYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNYRHRSTEGMSLKMVLMWTSGDTFKTAYFLLNGAPLQFSVCGLLQVMVDLAILGQAYAFAHHPQKPAPHAVHPASAKAL", "length": 253, "header": "tr|A0A8L2UR94-1|S66A2_RAT Computationally mapped isoform of Solute carrier family 66 member 2 OS=Rattus norvegicus OX=10116 GN=Slc66a2 PE=1 SV=1 CANONICAL=Q5M880-1" }, "locus": { "chromosome": "18", "start_pos": 73738754, "end_pos": 73704116, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000089389.2", "url": "https://www.ensembl.org/id/ENSRNOT00000089389.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000074262.2", "url": "https://www.ensembl.org/id/ENSRNOP00000074262.2" } ] } }, { "isoform_ac": "Q5M880-1", "url": "", "sequence": { "sequence": "MEAEGLGWLLVPLHQLVSWVAAGAMVFGGVVPYIPQYRDIRRTQNADGFSTHVCLVLLVANILRILFWFGRHFESPLLWQSIVMILTMLLMLKLCTEVRVANELNVKRRSFAATDSKDEELRVPPRRPYLDFDPHHFWHWSSFADYVQCVLAFTGVAGYITYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNYRHRSTEGMSLKMVLMWTSGDTFKTAYFLLNGAPLQFSVCGLLQVMVDLAILGQAYAFAHHPQKPAPHAVHPASAKAL", "length": 271, "header": "sp|Q5M880-1|S66A2_RAT Isoform 1 of Solute carrier family 66 member 2 OS=Rattus norvegicus OX=10116 GN=Slc66a2 PE=1 SV=2 CANONICAL=Q5M880-1" }, "locus": { "chromosome": "18", "start_pos": 73738754, "end_pos": 73704116, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000114669", "url": "https://www.ensembl.org/id/ENSRNOT00000114669" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000086993", "url": "https://www.ensembl.org/id/ENSRNOP00000086993" } ] } }, { "isoform_ac": "Q5M880-2", "url": "", "sequence": { "sequence": "MEAEGLGWLLVPLHQLVSWVAAGAMVFGGVVPYIPQYRDIRRTQNADGFSTHVCLVLLVANILRILFWFGRHFESPLLWQSIVMILTMLLMLKLCTEVRVANELNVKRRSFAATDSKDEELRVPPRRPYLGVAGYITYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNYRHRSTEGMSLKMVLMWTSGDTFKTAYFLLNGAPLQFSVCGLLQVMVDLAILGQAYAFAHHPQKPAPHAVHPASAKAL", "length": 247, "header": "sp|Q5M880-2|S66A2_RAT Isoform 2 of Solute carrier family 66 member 2 OS=Rattus norvegicus OX=10116 GN=Slc66a2 PE=1 SV=2 CANONICAL=Q5M880-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 110, "end_pos": 110, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q5M880", "url": "https://www.uniprot.org/uniprot/Q5M880" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "iPTMnet", "id": "Q5M880", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5M880" } ], "site_lbl": "Ser110" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nature communications", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "Q5M880", "url": "https://www.uniprot.org/uniprot/Q5M880" }, { "database": "iPTMnet", "id": "Q5M880", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5M880" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] } ], "pathway": [ { "id": "rno:361352", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:361352", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q80XM9-1", "protein_name": "Solute carrier family 66 member 2", "gene_name": "Slc66a2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEAEGLGWLLVPLHQLVSWVAAGAMVFGGVVPYIPQYRDIRRTQNADGFSTHVCLVLLVANILRILFWFGRHFESPLLWQSIVMILTMLLMLKLCTEVRVANELNIKRRSFAATDSKDEELRVPPRRPYLDFDPHHFWHWSSFSDYVQCVLAFTGVAGYITYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNYCHRSTEGMSLKMVLMWTSGDTFKTAYFLLNGAPLQFSVCGLLQVMVDLVILGQAYAFAHHPQKPAAHAVHPASTKAL", "length": 271 }, "evidence": [ { "id": "45243693", "url": "http://www.informatics.jax.org/homology/45243693", "database": "MGI" }, { "id": "Q5M880", "url": "https://omabrowser.org/oma/group/Q5M880/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8N2U9-1", "protein_name": "Solute carrier family 66 member 2", "gene_name": "SLC66A2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEAEGLDWLLVPLHQLVSWGAAAAMVFGGVVPYVPQYRDIRRTQNADGFSTYVCLVLLVANILRILFWFGRRFESPLLWQSAIMILTMLLMLKLCTEVRVANELNARRRSFTAADSKDEEVKVAPRRSFLDFDPHHFWQWSSFSDYVQCVLAFTGVAGYITYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMWTSGDAFKTAYFLLKGAPLQFSVCGLLQVLVDLAILGQAYAFARHPQKPAPHAVHPTGTKAL", "length": 271 }, "evidence": [ { "id": "45243693", "url": "http://www.informatics.jax.org/homology/45243693", "database": "MGI" }, { "id": "Q5M880", "url": "https://omabrowser.org/oma/group/Q5M880/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "endosome", "id": "GO:0005768", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005768", "evidence": [ { "database": "UniProtKB", "id": "Q5M880", "url": "https://www.uniprot.org/uniprot/Q5M880" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q5M880", "url": "https://www.uniprot.org/uniprot/Q5M880" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q5M880", "url": "https://www.uniprot.org/uniprot/Q5M880" } ], "pmid": "" }, { "name": "trans-Golgi network", "id": "GO:0005802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005802", "evidence": [ { "database": "UniProtKB", "id": "Q5M880", "url": "https://www.uniprot.org/uniprot/Q5M880" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "phospholipid translocation", "id": "GO:0045332", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045332", "evidence": [ { "database": "UniProtKB", "id": "Q5M880", "url": "https://www.uniprot.org/uniprot/Q5M880" } ], "pmid": "" }, { "name": "retrograde transport, endosome to Golgi", "id": "GO:0042147", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042147", "evidence": [ { "database": "UniProtKB", "id": "Q5M880", "url": "https://www.uniprot.org/uniprot/Q5M880" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }