{
    "uniprot_canonical_ac": "Q5M840-1",
    "uniprot_ac": "Q5M840",
    "uniprot_id": "G0S2_RAT",
    "mass": {
        "chemical_mass": 11232.0,
        "monoisotopic_mass": 11232.0
    },
    "refseq": {
        "ac": "NP_001009632",
        "name": "G0/G1 switch protein 2",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632"
    },
    "gene_names": [
        {
            "name": "G0s2",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q5M840",
            "id": "Q5M840"
        },
        {
            "name": "G0s2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632",
            "id": "NP_001009632"
        }
    ],
    "protein_names": [
        {
            "name": "G0/G1 switch protein 2",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q5M840"
        },
        {
            "name": "G0/G1 switch gene 2; putative lymphocyte G0/G1 switch; G0S2-like protein",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632",
            "id": "NP_001009632"
        },
        {
            "name": "G0/G1 switch protein 2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632",
            "id": "NP_001009632"
        },
        {
            "name": "G0S2-like protein",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q5M840"
        }
    ],
    "function": [
        {
            "annotation": "Administration of progesterone resulted in an increase in the expression of Abhd5 gene (whose product increases ATGL activity) and G0s2 gene (whose product decreases ATGL activity) in the inguinal white adipose tissue of female rats.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001009632",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632"
                },
                {
                    "database": "PubMed",
                    "id": "25448749",
                    "url": "https://glygen.org/publication/PubMed/25448749"
                }
            ]
        },
        {
            "annotation": "G0/G1 switch gene 2 has a role as a positive regulator of oxidative phosphorylation",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001009632",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632"
                },
                {
                    "database": "PubMed",
                    "id": "24344269",
                    "url": "https://glygen.org/publication/PubMed/24344269"
                }
            ]
        },
        {
            "annotation": "Promotes apoptosis by binding to BCL2, hence preventing the formation of protective BCL2-BAX heterodimers.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q5M840",
                    "url": "https://www.uniprot.org/uniprot/Q5M840#function"
                }
            ]
        },
        {
            "annotation": "Report increased levels of ATGL and its inhibitor G0S2 following endurance training in metabolically different rat skeletal muscles.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001009632",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632"
                },
                {
                    "database": "PubMed",
                    "id": "26511521",
                    "url": "https://glygen.org/publication/PubMed/26511521"
                }
            ]
        },
        {
            "annotation": "Results indicate that G0S2 acts as a prosurvival molecule in endothelial cells.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001009632",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632"
                },
                {
                    "database": "PubMed",
                    "id": "25588877",
                    "url": "https://glygen.org/publication/PubMed/25588877"
                }
            ]
        },
        {
            "annotation": "Results of the present study indicate that hepatic G0s2 protein may promote hepatic insulin resistance by exacerbating hepatic steatosis",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001009632",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632"
                },
                {
                    "database": "PubMed",
                    "id": "27624922",
                    "url": "https://glygen.org/publication/PubMed/27624922"
                }
            ]
        },
        {
            "annotation": "These data suggest that the content of G0S2 relative to the lipase in skeletal muscle would not predict lipolytic potential. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001009632",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632"
                },
                {
                    "database": "PubMed",
                    "id": "25811590",
                    "url": "https://glygen.org/publication/PubMed/25811590"
                }
            ]
        },
        {
            "annotation": "Upregulation of Pnpla2 expression and activation of ATGL (due to an increase in ABHD5 and decrease in G0S2 levels), as well as a coordinated interplay of these genes with Lipe in mesenteric WAT, contribute, at least in part, to an increase in the concentration of circulating NEFA in rats with reduced fat mass.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001009632",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632"
                },
                {
                    "database": "PubMed",
                    "id": "27590244",
                    "url": "https://glygen.org/publication/PubMed/27590244"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Rattus norvegicus",
            "taxid": 10116,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q5M840",
                    "url": "https://www.uniprot.org/uniprot/Q5M840"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "gene": [
        {
            "name": "G0s2",
            "url": "https://www.uniprot.org/uniprot/Q5M840",
            "locus": {
                "chromosome": "13",
                "start_pos": 104806156,
                "end_pos": 104807451,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSRNOG00000006019",
                        "url": "https://www.ensembl.org/id/ENSRNOG00000006019"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSRNOG00000006019",
            "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000006019",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "289388",
            "url": "https://www.ncbi.nlm.nih.gov/gene/289388",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR016821",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR016821",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "rno:289388",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:289388",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "ANRQHAS",
            "url": "https://omabrowser.org/oma/group/ANRQHAS/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "3869384at2759",
            "url": "http://www.orthodb.org/?query=3869384at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR15570",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15570",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR15570:SF2",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15570:SF2",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF15103",
            "url": "http://pfam.xfam.org/family/PF15103",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q5M840",
            "url": "http://purl.obolibrary.org/obo/PR_Q5M840",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_001009632",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "1311675",
            "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1311675",
            "database": "RGD",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "Q5M840",
            "url": "https://www.uniprot.org/uniprot/Q5M840",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q5M840-1",
            "url": "https://www.uniprot.org/uniprot/Q5M840-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MESVQELIPLAKEMMTQKSRGKLVKLYVLGSVLAFFGVVLGLVETVCSPFTAASRLRDQEAAVAELRDACEQQSLHKQALIAEGKTQEATLCSRALSLRQHAS",
        "length": 103,
        "header": "sp|Q5M840-1|G0S2_RAT Isoform 1 of G0/G1 switch protein 2  OS=Rattus norvegicus OX=10116 GN=G0s2 PE=3 SV=1 CANONICAL=Q5M840-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q5M840-1",
            "url": "",
            "sequence": {
                "sequence": "MESVQELIPLAKEMMTQKSRGKLVKLYVLGSVLAFFGVVLGLVETVCSPFTAASRLRDQEAAVAELRDACEQQSLHKQALIAEGKTQEATLCSRALSLRQHAS",
                "length": 103,
                "header": "sp|Q5M840-1|G0S2_RAT Isoform 1 of G0/G1 switch protein 2  OS=Rattus norvegicus OX=10116 GN=G0s2 PE=3 SV=1 CANONICAL=Q5M840-1"
            },
            "locus": {
                "chromosome": "13",
                "start_pos": 104806983,
                "end_pos": 104806675,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSRNOT00000007879",
                        "url": "https://www.ensembl.org/id/ENSRNOT00000007879"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSRNOP00000007879",
                        "url": "https://www.ensembl.org/id/ENSRNOP00000007879"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Evaluation of intramitochondrial ATP levels identifies G0/G1 switch gene 2 as a positive regulator of oxidative phosphorylation.",
            "journal": "Proceedings of the National Academy of Sciences of the United States of America",
            "date": "2014",
            "authors": "Kioka H, Kato H, Fujikawa M, Tsukamoto O, Suzuki T, Imamura H, Nakano A, Higo S, Yamazaki S, Matsuzaki T, Takafuji K, Asanuma H, Asakura M, Minamino T, Shintani Y, Yoshida M, Noji H, Kitakaze M, Komuro I, Asano Y, Takashima S",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001009632",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24344269",
                    "url": "https://glygen.org/publication/PubMed/24344269"
                }
            ]
        },
        {
            "title": "Progesterone-induced down-regulation of hormone sensitive lipase (Lipe) and up-regulation of G0/G1 switch 2 (G0s2) genes expression in inguinal adipose tissue of female rats is reflected by diminished rate of lipolysis.",
            "journal": "The Journal of steroid biochemistry and molecular biology",
            "date": "2015",
            "authors": "Stelmanska E, Szrok S, Swierczynski J",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001009632",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25448749",
                    "url": "https://glygen.org/publication/PubMed/25448749"
                }
            ]
        },
        {
            "title": "Lipolytic inhibitor G0/G1 switch gene 2 inhibits reactive oxygen species production and apoptosis in endothelial cells.",
            "journal": "American journal of physiology. Cell physiology",
            "date": "2015",
            "authors": "Wang Y, Zhang Y, Zhu Y, Zhang P",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001009632",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25588877",
                    "url": "https://glygen.org/publication/PubMed/25588877"
                }
            ]
        },
        {
            "title": "Characterization of lipolytic inhibitor G(0)/G(1) switch gene-2 protein (G0S2) expression in male Sprague-Dawley rat skeletal muscle compared to relative content of adipose triglyceride lipase (ATGL) and comparitive gene identification-58 (CGI-58).",
            "journal": "PloS one",
            "date": "2015",
            "authors": "Turnbull PC, Ramos SV, MacPherson RE, Roy BD, Peters SJ",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001009632",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25811590",
                    "url": "https://glygen.org/publication/PubMed/25811590"
                }
            ]
        },
        {
            "title": "Increases in skeletal muscle ATGL and its inhibitor G0S2 following 8 weeks of endurance training in metabolically different rat skeletal muscles.",
            "journal": "American journal of physiology. Regulatory, integrative and comparative physiology",
            "date": "2016",
            "authors": "Turnbull PC, Longo AB, Ramos SV, Roy BD, Ward WE, Peters SJ",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001009632",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "26511521",
                    "url": "https://glygen.org/publication/PubMed/26511521"
                }
            ]
        },
        {
            "title": "Upregulation of Pnpla2 and Abhd5 and downregulation of G0s2 gene expression in mesenteric white adipose tissue as a potential reason for elevated concentration of circulating NEFA after removal of retroperitoneal, epididymal, and inguinal adipose tissue.",
            "journal": "Molecular and cellular biochemistry",
            "date": "2016",
            "authors": "Dettlaff-Pokora A, Sledzinski T, Swierczynski J",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001009632",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27590244",
                    "url": "https://glygen.org/publication/PubMed/27590244"
                }
            ]
        },
        {
            "title": "Liver-specific G0 /G1 switch gene 2 (G0s2) expression promotes hepatic insulin resistance by exacerbating hepatic steatosis in male Wistar rats.",
            "journal": "Journal of diabetes",
            "date": "2017",
            "authors": "Sugaya Y, Satoh H",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001009632",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009632"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27624922",
                    "url": "https://glygen.org/publication/PubMed/27624922"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "rno:289388",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:289388",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "P27469-1",
            "protein_name": "G0/G1 switch protein 2",
            "gene_name": "G0S2",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS",
                "length": 103
            },
            "evidence": [
                {
                    "id": "45238274",
                    "url": "http://www.informatics.jax.org/homology/45238274",
                    "database": "MGI"
                },
                {
                    "id": "Q5M840",
                    "url": "https://omabrowser.org/oma/group/Q5M840/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q61585-1",
            "protein_name": "G0/G1 switch protein 2",
            "gene_name": "G0s2",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MESVQELIPLAKEMMAQKPRGKLVKLYVLGSVLALFGVVLGLVETVCSPFTAASRLRDQEAAVVELREACEQQSLHKQALLAGGKAQEATLCSRALSLRQHAS",
                "length": 103
            },
            "evidence": [
                {
                    "id": "45238274",
                    "url": "http://www.informatics.jax.org/homology/45238274",
                    "database": "MGI"
                },
                {
                    "id": "Q5M840",
                    "url": "https://omabrowser.org/oma/group/Q5M840/",
                    "database": "OMA"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "mitochondrion",
                        "id": "GO:0005739",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q5M840",
                                "url": "https://www.uniprot.org/uniprot/Q5M840"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 4,
                "go_terms": [
                    {
                        "name": "positive regulation of extrinsic apoptotic signaling pathway",
                        "id": "GO:2001238",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001238",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q5M840",
                                "url": "https://www.uniprot.org/uniprot/Q5M840"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell cycle",
                        "id": "GO:0007049",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007049",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q5M840",
                                "url": "https://www.uniprot.org/uniprot/Q5M840"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "extrinsic apoptotic signaling pathway",
                        "id": "GO:0097191",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097191",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q5M840",
                                "url": "https://www.uniprot.org/uniprot/Q5M840"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of cold-induced thermogenesis",
                        "id": "GO:0120162",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120162",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q5M840",
                                "url": "https://www.uniprot.org/uniprot/Q5M840"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 7
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}