{ "uniprot_canonical_ac": "Q5JCS9-1", "uniprot_ac": "Q5JCS9", "uniprot_id": "B3GN3_MOUSE", "mass": { "chemical_mass": 42586.0, "monoisotopic_mass": 42586.0 }, "refseq": { "ac": "NP_082465", "name": "N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082465" }, "gene_names": [ { "name": "B3gnt3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5JCS9", "id": "Q5JCS9" }, { "name": "2210008L19Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082465", "id": "NP_082465" }, { "name": "B3gnt3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082465", "id": "NP_082465" } ], "protein_names": [ { "name": "N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q5JCS9" }, { "name": "2.4.1.146", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5JCS9" }, { "name": "2.4.1.149", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5JCS9" }, { "name": "BGnT-3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5JCS9" }, { "name": "Beta-1,3-Gn-T3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5JCS9" }, { "name": "Beta-1,3-N-acetylglucosaminyltransferase 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5JCS9" }, { "name": "Beta3Gn-T3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5JCS9" }, { "name": "Core 1 extending beta-1,3-N-acetylglucosaminyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5JCS9" }, { "name": "Core1-beta3GlcNAcT", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5JCS9" }, { "name": "N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082465", "id": "NP_082465" }, { "name": "UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5JCS9" }, { "name": "core 1 beta-1,3-N-acetylglucosaminyltransferase; BGnT-3; beta3Gn-T3; beta-1,3-Gn-T3; core1-beta3GlcNAcT; beta-1,3-N-acetylglucosaminyltransferase 3; core 1 extending beta-1,3-N-acetylglucosaminyltransferase; N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082465", "id": "NP_082465" } ], "function": [ { "annotation": "Beta-1,3-N-acetylglucosaminyltransferase involved in the synthesis of poly-N-acetyllactosamine. Has activity for type 2 oligosaccharides. Also acts as a core1-1,3-N-acetylglucosaminyltransferase (Core1-beta3GlcNAcT) to form the 6-sulfo sialyl Lewis x on extended core1 O-glycans.", "evidence": [ { "database": "UniProtKB", "id": "Q5JCS9", "url": "https://www.uniprot.org/uniprot/Q5JCS9#function" }, { "database": "UniProtKB", "id": "Q9Y2A9", "url": "https://www.uniprot.org/uniprot/Q9Y2A9#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q5JCS9", "url": "https://www.uniprot.org/uniprot/Q5JCS9" } ], "common_name": "Mouse" } ], "gene": [ { "name": "B3gnt3", "url": "https://www.uniprot.org/uniprot/Q5JCS9", "locus": { "chromosome": "8", "start_pos": 72143400, "end_pos": 72154433, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000031803", "url": "https://www.ensembl.org/id/ENSMUSG00000031803" } ] } } ], "crossref": [ { "id": "ENSMUSG00000031803", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000031803", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "GT31", "url": "http://www.cazy.org/GT31.html", "database": "CAZy", "categories": [ "Protein Classification" ] }, { "id": "72297", "url": "https://www.ncbi.nlm.nih.gov/gene/72297", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0005317", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0005317", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "IPR002659", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002659", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:72297", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:72297", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2152535", "url": "http://www.informatics.jax.org/marker/MGI:2152535", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "VSYLQGH", "url": "https://omabrowser.org/oma/group/VSYLQGH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "532757at2759", "url": "http://www.orthodb.org/?query=532757at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11214", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11214", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11214:SF370", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11214:SF370", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01762", "url": "http://pfam.xfam.org/family/PF01762", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q5JCS9", "url": "http://purl.obolibrary.org/obo/PR_Q5JCS9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2022854", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-913709", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_082465", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082465", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "14389", "url": "https://www.rhea-db.org/rhea/14389", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "56220", "url": "https://www.rhea-db.org/rhea/56220", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "56224", "url": "https://www.rhea-db.org/rhea/56224", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q5JCS9", "url": "https://www.uniprot.org/uniprot/Q5JCS9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JCS9-1", "url": "https://www.uniprot.org/uniprot/Q5JCS9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRLPRQSPYEILLLVLVALLVLLLLLTSKSPPSCSAPERSKEPEDNPGWATGHPRTHPARCRANLSVSSHPDFAGLPLHVRDFLFYRHCRDFPVLREPRVTKCAEPVFLLLAIKSSPANYGRRQMLRTTWARERRVRGAPLRRLFLVGSDRDPQQARKYNRLLELEAQKYGDILQWDFHDSFFNLTLKQVLFLEWQLTYCTNASFVLNGDDDVFAHTDNMVTYLQDHDPDQHLFVGHLIQNVGPIRVPWSKYFIPALVMAEDRYPPYCGGGGFLLSRFTVAALRRAARVLPMFPIDDVFLGMCLQQQGLAPGTHSGVRTAGVFPPSPRVSSFDPCFYRDLLLVHRFLPFEMLLMWDALNQPQLLCGRQSPAY", "length": 372, "header": "sp|Q5JCS9-1|B3GN3_MOUSE Isoform 1 of N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Mus musculus OX=10090 GN=B3gnt3 PE=2 SV=1 CANONICAL=Q5JCS9-1" }, "isoforms": [ { "isoform_ac": "Q5JCS9-1", "url": "", "sequence": { "sequence": "MRLPRQSPYEILLLVLVALLVLLLLLTSKSPPSCSAPERSKEPEDNPGWATGHPRTHPARCRANLSVSSHPDFAGLPLHVRDFLFYRHCRDFPVLREPRVTKCAEPVFLLLAIKSSPANYGRRQMLRTTWARERRVRGAPLRRLFLVGSDRDPQQARKYNRLLELEAQKYGDILQWDFHDSFFNLTLKQVLFLEWQLTYCTNASFVLNGDDDVFAHTDNMVTYLQDHDPDQHLFVGHLIQNVGPIRVPWSKYFIPALVMAEDRYPPYCGGGGFLLSRFTVAALRRAARVLPMFPIDDVFLGMCLQQQGLAPGTHSGVRTAGVFPPSPRVSSFDPCFYRDLLLVHRFLPFEMLLMWDALNQPQLLCGRQSPAY", "length": 372, "header": "sp|Q5JCS9-1|B3GN3_MOUSE Isoform 1 of N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Mus musculus OX=10090 GN=B3gnt3 PE=2 SV=1 CANONICAL=Q5JCS9-1" }, "locus": { "chromosome": "8", "start_pos": 72146527, "end_pos": 72145251, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000034260", "url": "https://www.ensembl.org/id/ENSMUST00000034260" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000034260", "url": "https://www.ensembl.org/id/ENSMUSP00000034260" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 184, "start_aa": "Asn", "end_pos": 184, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn184", "evidence": [ { "id": "Q5JCS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JCS9#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 202, "start_aa": "Asn", "end_pos": 202, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn202", "evidence": [ { "id": "Q5JCS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JCS9#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "Q5JCS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JCS9#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycosyltransferase-activity", "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [ { "id": "mmu:72297", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:72297", "resource": "KEGG Pathway" }, { "id": "R-MMU-2022854", "name": "Keratan sulfate biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2022854", "resource": "Reactome", "description": "Keratan sulfate biosynthesis" }, { "id": "R-MMU-913709", "name": "O-linked glycosylation of mucins", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-913709", "resource": "Reactome", "description": "O-linked glycosylation of mucins" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZX31-1", "protein_name": "Hexosyltransferase", "gene_name": "B3gnt3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRLPRLRPVVSLLLALAALLLLLTCQSPPSCPAPESPTEPKDDPAWAPDLSRAHAAPCRANLSVSAHPAFARLPSHVRDFLLYRHCRDFAVLREPKATKCAQPAFLLLAIKSSPANYGRRQVLRTTWARERRVRGASLRRLFLVGSDRDPQQARKFNRLLELEAKAYGDILQWDFHDSFFNLTLKQVLFLEWQRTHCTNASFVLNGDDDVFAHTDNMVTYLQGRDPDQHLFVGHLIQNVGPIRVPWSKYFIPTLVTAEDKYPPYCGGGGFLLSRFTMAALHRAARVLPIFPIDDVFLGMCLQQQGLAPGAHSGVRTAGVLPPSPRVSSFDPCFYRDLLLVHRFLPFEMLLMWDALSRPQLACGRQSPPLLTGLGGRHP", "length": 378 }, "evidence": [ { "id": "45238155", "url": "http://www.informatics.jax.org/homology/45238155", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9Y2A9-1", "protein_name": "N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3", "gene_name": "B3GNT3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKYLRHRRPNATLILAIGAFTLLLFSLLVSPPTCKVQEQPPAIPEALAWPTPPTRPAPAPCHANTSMVTHPDFATQPQHVQNFLLYRHCRHFPLLQDVPPSKCAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYLQDHDPGRHLFVGQLIQNVGPIRAFWSKYYVPEVVTQNERYPPYCGGGGFLLSRFTAAALRRAAHVLDIFPIDDVFLGMCLELEGLKPASHSGIRTSGVRAPSQRLSSFDPCFYRDLLLVHRFLPYEMLLMWDALNQPNLTCGNQTQIY", "length": 372 }, "evidence": [ { "id": "45238155", "url": "http://www.informatics.jax.org/homology/45238155", "database": "MGI" }, { "id": "Q5JCS9", "url": "https://omabrowser.org/oma/group/Q5JCS9/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "Q5JCS9", "url": "https://www.uniprot.org/uniprot/Q5JCS9" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q5JCS9", "url": "https://www.uniprot.org/uniprot/Q5JCS9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "protein O-linked glycosylation", "id": "GO:0006493", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006493", "evidence": [ { "database": "UniProtKB", "id": "Q5JCS9", "url": "https://www.uniprot.org/uniprot/Q5JCS9" } ], "pmid": "" }, { "name": "poly-N-acetyllactosamine biosynthetic process", "id": "GO:0030311", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030311", "evidence": [ { "database": "UniProtKB", "id": "Q5JCS9", "url": "https://www.uniprot.org/uniprot/Q5JCS9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase activity", "id": "GO:0008532", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008532", "evidence": [ { "database": "UniProtKB", "id": "Q5JCS9", "url": "https://www.uniprot.org/uniprot/Q5JCS9" } ], "pmid": "" }, { "name": "beta-galactosyl-N-acetylglucosaminylgalactosylglucosyl-ceramide beta-1,3-acetylglucosaminyltransferase activity", "id": "GO:0008457", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008457", "evidence": [ { "database": "UniProtKB", "id": "Q5JCS9", "url": "https://www.uniprot.org/uniprot/Q5JCS9" } ], "pmid": "" }, { "name": "beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase activity", "id": "GO:0047223", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047223", "evidence": [ { "database": "UniProtKB", "id": "Q5JCS9", "url": "https://www.uniprot.org/uniprot/Q5JCS9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 184, "end_pos": 186, "annotation": "n_glycosylation_sequon" }, { "start_pos": 202, "end_pos": 204, "annotation": "n_glycosylation_sequon" }, { "start_pos": 64, "end_pos": 66, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "14389", "name": "", "equation": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-N-acetyl-alpha-D-glucosamine = an N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Y2A9-1", "Q9C0J1-1", "Q9NY97-1", "Q9Z222-1", "Q1RLK6-1", "Q5JCS9-1" ], "evidence": [ { "id": "14389", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/14389" } ] }, { "id": "56220", "name": "", "equation": "3-O-{beta-D-galactosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl}-L-seryl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-{beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->3)-[beta-D-GlcNAc-(1->6)]-alpha-D-GalNAc}-L-seryl-[protein] + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Y2A9-1", "Q5JCS9-1" ], "evidence": [ { "id": "56220", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/56220" } ] }, { "id": "56224", "name": "", "equation": "3-O-{beta-D-galactosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl}-L-threonyl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-{beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->3)-[beta-D-GlcNAc-(1->6)]-alpha-D-GalNAc}-L-threonyl-[protein] + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Y2A9-1", "Q5JCS9-1" ], "evidence": [ { "id": "56224", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/56224" } ] }, { "id": "R-MMU-2025724", "name": "B3GNT1,2,3,4,7 add GlcNAc to form Keratan-PG", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8BWP8-1", "Q1RLK6-1", "Q5JCS9-1", "Q8K0J2-1", "Q9Z222-1" ], "evidence": [ { "id": "R-MMU-2025724", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2025724" } ] }, { "id": "R-MMU-914010", "name": "Addition of GlcNAc to the Tn antigen forms a Core 3 glycoprotein", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8R3I9-1", "Q3USF0-1", "Q1RLK6-1", "Q3U129-1", "Q5JCS9-1", "Q8BGY6-1", "Q8K0J2-1", "Q8VI16-1", "Q9Z222-1" ], "evidence": [ { "id": "R-MMU-914010", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-914010" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "Q1RLK6", "gene_name": "B3gnt4", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "Q1RLK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1RLK6" } ] }, { "ec_number": "2.4.1.149", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-N-acetyl-alpha-D-glucosamine = an N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q1RLK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1RLK6" } ] }, { "ec_number": "2.4.1.149", "activity": "", "evidence": [ { "id": "Q1RLK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1RLK6" } ] } ] }, { "uniprot_ac": "Q3U129", "gene_name": "B3gntl1", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "Q3U129", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U129" } ] } ] }, { "uniprot_ac": "Q3USF0", "gene_name": "B3gnt6", "activity": [ { "ec_number": "2.4.1.147", "activity": "3-O-[N-acetyl-alpha-D-galactosaminyl]-L-threonyl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-[N-acetyl-beta-D-glucosaminyl-(1->3)-N-acetyl-alpha-D-galactosaminyl]-L-threonyl-[protein] + H(+) + UDP.", "evidence": [ { "id": "Q3USF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3USF0" } ] }, { "ec_number": "2.4.1.147", "activity": "", "evidence": [ { "id": "Q3USF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3USF0" } ] } ] }, { "uniprot_ac": "Q5JCS9", "gene_name": "B3gnt3", "activity": [ { "ec_number": "2.4.1.149", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-N-acetyl-alpha-D-glucosamine = an N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q5JCS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JCS9" } ] }, { "ec_number": "2.4.1.146", "activity": "3-O-{beta-D-galactosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl}-L-threonyl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-{beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->3)-[beta-D-GlcNAc-(1->6)]-alpha-D-GalNAc}-L-threonyl-[protein] + H(+) + UDP.", "evidence": [ { "id": "Q5JCS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JCS9" } ] }, { "ec_number": "2.4.1.149", "activity": "", "evidence": [ { "id": "Q5JCS9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5JCS9" } ] } ] }, { "uniprot_ac": "Q8BGY6", "gene_name": "B3gnt5", "activity": [ { "ec_number": "2.4.1.206", "activity": "a beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + UDP-N-acetyl-alpha-D-glucosamine = a beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + H(+) + UDP.", "evidence": [ { "id": "Q8BGY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGY6" } ] }, { "ec_number": "2.4.1.206", "activity": "", "evidence": [ { "id": "Q8BGY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGY6" } ] } ] }, { "uniprot_ac": "Q8BWP8", "gene_name": "B4gat1", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "Q8BWP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWP8" } ] } ] }, { "uniprot_ac": "Q8K0J2", "gene_name": "B3gnt7", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "Q8K0J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K0J2" } ] } ] }, { "uniprot_ac": "Q8R3I9", "gene_name": "B3gnt8", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "Q8R3I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3I9" } ] } ] }, { "uniprot_ac": "Q8VI16", "gene_name": "B3gnt9", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "Q8VI16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VI16" } ] } ] }, { "uniprot_ac": "Q9C0J1", "gene_name": "B3GNT4", "activity": [ { "ec_number": "2.4.1.149", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-N-acetyl-alpha-D-glucosamine = an N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q9C0J1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9C0J1" } ] }, { "ec_number": "2.4.1.149", "activity": "", "evidence": [ { "id": "Q9C0J1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9C0J1" } ] } ] }, { "uniprot_ac": "Q9NY97", "gene_name": "B3GNT2", "activity": [ { "ec_number": "2.4.1.149", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-N-acetyl-alpha-D-glucosamine = an N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q9NY97", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NY97" } ] }, { "ec_number": "2.4.1.149", "activity": "", "evidence": [ { "id": "Q9NY97", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NY97" } ] } ] }, { "uniprot_ac": "Q9Y2A9", "gene_name": "B3GNT3", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "Q9Y2A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2A9" } ] }, { "ec_number": "2.4.1.149", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-N-acetyl-alpha-D-glucosamine = an N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q9Y2A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2A9" } ] }, { "ec_number": "2.4.1.146", "activity": "3-O-{beta-D-galactosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl}-L-threonyl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-{beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->3)-[beta-D-GlcNAc-(1->6)]-alpha-D-GalNAc}-L-threonyl-[protein] + H(+) + UDP.", "evidence": [ { "id": "Q9Y2A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2A9" } ] }, { "ec_number": "2.4.1.149", "activity": "", "evidence": [ { "id": "Q9Y2A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2A9" } ] } ] }, { "uniprot_ac": "Q9Z222", "gene_name": "B3GNT2", "activity": [ { "ec_number": "2.4.1.149", "activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + UDP-N-acetyl-alpha-D-glucosamine = an N-acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q9Z222", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z222" } ] }, { "ec_number": "2.4.1.149", "activity": "", "evidence": [ { "id": "Q9Z222", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z222" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [ { "glytoucan_ac": "G00069YC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00164QP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00287UD", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G00376RB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00560KG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00569WM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G00675GF", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G00872ZT", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G00891GP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G00967VH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G00979XR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01116MS", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G01316HN", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G01450RG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G01520KE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01546PE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G01666SB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G01674VT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01682LD", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G01802HL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01879FC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02078ZZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02150AC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02297WO", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G02353KU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G02379AH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02403ZU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02613LD", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G02799CL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G02844SX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G02873KW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G02912JK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02990AF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03049NB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G03140AX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03505EQ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G03796EF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G03989SP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G04043RM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04130SK", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G04185QP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04324CR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04421LE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04478DK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04513DL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G04608YG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G04765GH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05278GV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05410WY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G05784QE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05785JJ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G05835TV", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G05848DX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06342XU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G06404BM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06448OR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06460LD", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G06503AU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06662ZP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06676BQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06786CI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06864JC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06963BI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G06990BX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G07141OG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07164WO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G07191NE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07443RM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07479EG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G07676GT", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G07677VL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07680WY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08033FI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G08201TX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08244YE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08306FC", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G08308ZP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08382XT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08566CQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08660AA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G08700OQ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G08715FO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G08784DO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09154YX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09185DX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09781FH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09845DR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10023KT", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G10082ZS", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G10148CV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G10180QX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10204GU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G10325PN", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G10705PR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G10818TP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G10859BP", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G10925II", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10954DW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11061VC", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G11078XZ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G11105TT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11259WE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G11260US", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G11373TT", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G11863CH", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G12032IY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G12232OT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12365RQ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G12455XO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G12493UH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G12573LN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12573WR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12697UE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G12761QA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G12962XA", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G13179FD", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G13204HV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G13205MF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G13258AZ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G13292XY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13346PK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13483MW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13500IP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G13767YY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G13785BU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13934YV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G14133PN", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G14250HG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G14375KO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14442NU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G14676JD", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G14812IG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G15173TI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G15631KB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15642UW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G15718TL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15779LH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15870AR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G16078YI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16438UK", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G16440EL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G16458JH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G16568AK", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G16598VU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G16609LV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G16617HJ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G16739XD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16768QV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16867VE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16975LY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G16982ND", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G16984QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17039ZC", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G17050CK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17126MK", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G17241OS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17300DB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17331IX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17346NI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17454VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17456TE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G17667YX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G17673XH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17740TV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17743FY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G17758YV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G17765UK", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G18067AF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G18078JT", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G18463FK", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G18559LN", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G18559VR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18853HA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19029ID", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19043KB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G19238ZQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19283CF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G19664QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19756XC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19793TF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G20061RO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G20210OT", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G20222KH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20440GC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20860NB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20867OR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G20884IJ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G21297DP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G21373SZ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G21385AQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21573GX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G21905ZO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22498IQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22733YM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G22793FR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22976NF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G23048PE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23066SI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23193CN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23314QX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G23425OX", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G23560WQ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G23674BI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23893ZL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23975EE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24186OV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G24327KR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24407ZG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24516WB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G24739SA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24970IL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G25064SU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25153GE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25380IT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25382RS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25436EB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G25489WW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G25538MM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25612EW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25705WX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G25716MV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25804XU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25848FU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26121MN", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G26228QQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26341TZ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G26712CT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26725PG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G26885DO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G27092AU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G27192WV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G27236KE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27409LG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27499KV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G27655DO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27967WE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G28023AU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28040SC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28116PK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28132XE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28200CZ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G28326EU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28329XZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28378XH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G28749YQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28886HO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G29348FH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G29418HB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29489PN", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G29495CE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29539ZA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G29644TC", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G29667VM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G29879FQ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G29914BX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G30011VO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G30086CM", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G30182VC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30211JD", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G30232EU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G30255XL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30356CR", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G30392XP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30434QC", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G30590EC", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G30697FM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G30835JV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G30853JB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G30871VQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31101EW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31729QS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31822CM", "type": "N-linked", "subtype": "Complex" }, { "glytoucan_ac": "G31997DH", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G32460TA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G33012HL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G33064PF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G33236UO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G33286MK", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G33403VX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G33479HZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33652MJ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G33669VL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G33860PM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34049BA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34096TA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34100DU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34123VN", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G34143CH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34168KI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G34336BJ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G34479QF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G34706DW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34891MO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34962LY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35338HV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G35419IZ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G35451HW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G35632SP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35745YL", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G35799DH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35825BV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35866KN", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G35898DT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35932XK", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G35941VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35946GZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36039YA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G36046VV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36157LL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G36171FU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G36184OR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36258NK", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G36359GN", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G36406GU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36460YS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36480VP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G36482YM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36588NK", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G36761DZ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G36786TD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36835IG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G36970ZN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37043BS", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G37134CP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37231JH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G37282LW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37354FL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37528JY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37597VQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37638KH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37716XX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37861OJ", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G37885HZ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G38002BK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38027UF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38207GT", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G38296RM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38316MW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38462TG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38465NT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38468XG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38616ID", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G38754AX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38975ZC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39011WZ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G39098FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39246KD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39260NC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39283IB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39393JJ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G39422JF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G39423SD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39516UK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39611QP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G39650IP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39676NA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39720OK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39916NT", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G40069TO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G40107NH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40294ED", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40319SF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40347YM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40397HC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40792HV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40813RE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G40838GB", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G41255BI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41321IO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G41324RH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G41358UX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41424HD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41540NH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41545LH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41896LD", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G42039AA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42120JR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G42154JB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G42206TU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42245KI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42814RP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42818YG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G42828SU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42993UG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G43426MU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G43668RJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43925AD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44127LD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44342ZF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G44463UK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44504WW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G44848OP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G45003LE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G45291XZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45304AE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G45313PF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G45333LE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G45333UL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G45388VA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G45402WV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45707SN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45709SU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G45756EL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45767XH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G45819SH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G45917UD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46029TT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46039GY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46088YW", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G46222DM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G46304CE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G46340EI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G46382BV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G46500XL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G46503UI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G46520QG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46609ZR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G46627WE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46681XX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G46754UT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46758LT", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G46935AJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47307MO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47452EQ", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G47519RD", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G47669CK", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G47709SA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47892HA", "type": "N-linked", "subtype": "Complex" }, { "glytoucan_ac": "G48129FF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48265YT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48367ZH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G48499NG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48585WR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G48678VC", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G49349BS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49370IN", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G49499SW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49529DV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G49844LC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50003EV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50178BS", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G50215WR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50223FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50254UQ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G50362JF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50652EJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50690RS", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G50709IS", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G50808YS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50849OF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50896EJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50937OW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51005JI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G51018LC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51020FB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G51216AJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51473GI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G51554PH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51557QE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51566FN", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G51722JR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G51726CK", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G51992CI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52179YJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52217QW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G52262VT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52316LQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52376IF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52380IS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52515QC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52916PO", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G52937XP", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G52972TJ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G53000BS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53023PP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G53066XA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G53220ZS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53225BR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53246IE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53303ZX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53440PM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G53682MP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53834TX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G54125VH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54199ZM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G54212AC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54451EW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G54461SS", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G54650UF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G54651DQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54727BI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G54745KD", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G54760IB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G55025YG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G55037II", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G55043JL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55331YF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55398ID", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G55459MJ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G55664FE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G55781KV", "type": "N-linked", "subtype": "Complex" }, { "glytoucan_ac": "G55866KK", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G56042JM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G56067ON", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G56077PT", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G56427WT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G56920BC", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G56946CM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G57007FO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G57144YM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G57166CI", "type": "N-linked", "subtype": "Complex" }, { "glytoucan_ac": "G57249PT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57296XM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G57510LQ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G57545VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57672ST", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G57772TI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57803ND", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G57836JM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57840ZW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57872KZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58078TR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58106KY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G58181OH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G58201OX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58501OI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G58577QT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58695FX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G58699ZC", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G58793GF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G58846EV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G58952ZX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G59035KA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59212FY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G59740UO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59746EH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59747EH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G59930AW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59973RN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60457MA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60725IW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G60731ZH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60755CL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G61094XY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G61176JH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G61501FW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G61747RH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G62014UA", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G62015ZM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G62055DD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62278MB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62311FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62382LX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62414VY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G62741IO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G62820PI", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G62824TL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G62980KY", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G63193BW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63194GH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63209WI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63242HY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G63258OL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63324SB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63342TJ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G63343WQ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G63377SE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G63404EE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63405JW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G63443GA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G63527PL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G63664GB", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G63717SU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G63754TT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63858YS", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G64165TJ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G64206XB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64305XQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64485VT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64566OC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64604UL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G64712UU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G64774WV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64849QZ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G64852XI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64904QS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64981YW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G65037OI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65249DN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65364FS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65369IB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65600KO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65602FX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G65704VY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G65728QH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G65796KU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G65852GY", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G65909WP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G66166BF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66188DL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66213WH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G66662KA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G66967KV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G67371HE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G67407NJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67686RZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67695RM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G67775HG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67821CP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67959IK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68175FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68210RO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68306RK", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G68384KC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68391RZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68412PR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G68614NL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68893BQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68894XH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68956JQ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G69033GJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69137GO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69185XX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69479TC", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G69788BR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G69824GC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70080NT", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G70081ZH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70125XL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70146PH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G70579MZ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G70582LE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G70623QI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G70631UV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70928KV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G71202JE", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G71249CV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G71306LD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71479KG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71506JZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71549TN", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G71707QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71713QS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71773FH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71835SV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71964JP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71989CT", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G71999UY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72070EH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72263DG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G72298WI", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G72319HC", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G72379PC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72729HN", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G72734AU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G72827OW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72992IV", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G73019DE", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G73203OQ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G73323VU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73373AY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G73544PN", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G73653TX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73723ZY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73760YR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G74049SP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G74473MP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74484ON", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74678FD", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G74684ZW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G74758HW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G74855SC", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G74918VW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74945NC", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G74950DJ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G75042KU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75121VU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G75171WW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75376YT", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G75408KS", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G75453GL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G75472OU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G75586OT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75594JP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75637RB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75704MB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75749JP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G75786FQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75924IA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G75975LI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G75999PF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76082SD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76370WH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G76387IG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76465IY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76505ZE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76603DR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G76703CC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76726PJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76748ZU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76789KR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G76876LB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76997PL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G77136XW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77149IZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77311AH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G77477NL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G77481LZ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G77633IZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78034SR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G78104ML", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G78202HA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G78239OD", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G78475DU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G78482IS", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G78757VY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78788QJ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G78856SO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G78918BK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78928PU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G78990OC", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G79137TM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G79222ND", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79246GM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G79464QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79762CW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79788QE", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G79798AT", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G79968EZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80188JS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80251DR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G80306SV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G80308BA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G80577OW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G80726UW", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G80951VR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80960YD", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G81167HN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81439BR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G81825YE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81832CY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G81832XS", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G82092PV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82133EG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82152YZ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G82216JH", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G82334OE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82362HL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82366DK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82512PT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82693QG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82785ZH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83080DP", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G83206CA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83412LT", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G83808HF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G83950JR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G83998HE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84071MB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G84146JE", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G84205RB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G84366AE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84398ZW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84515GE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84532IX", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G84559PU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G85049LD", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G85083RQ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G85174VD", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G85284LO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85310SF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85366AQ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G85431OK", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G85483NO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G85670FA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85736BH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85972OZ", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G85972YO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86013XY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86085HN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86375CM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G86387VT", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G86389LM", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G86533KK", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G86669AN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86718YQ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G86733FM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86861MW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G86979CW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G87218FV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G87256FP", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G87444MS", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G87574LM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87666TN", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G87683NV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G87755UZ", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G87819IQ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G87935YG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G87945CD", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G88050IP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88216WD", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G88376DR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G88432QZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88687UE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88975RE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89009CR", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G89058LG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G89136NX", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G89242LQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89585FG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G89611JH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G89661WR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89946SW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G89990JE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90135ZJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90251SV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90689AW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G90789UO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G90829NZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90901EO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G90999PU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91047NA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G91322OS", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G91459EI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91484XT", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G91618RS", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G91637SF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91659ZV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G91732VA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91775YA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G92019ZO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G92155IO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92175OV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92179IH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G92324IJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92354TO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92358PV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G92485YK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92716MQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92928SW", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G93045SX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93088DU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93213IL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G93333OF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93450CE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93470LV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G93520MA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G93526OI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G93577ZC", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G93636BY", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G93941QH", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G94058TU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94146NJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94180RN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G94374SB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G94517VF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94599QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94615OV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94705OR", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G94768NG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94817WU", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G94850KK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94941PK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95006CL", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G95114RJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95144UL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G95324VU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95397YW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G95438ID", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G95448VV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95615QI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G95740GH", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G95981KO", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G96067FK", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G96079CK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96334ZO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96373OE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96425TB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G96746BC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96763TB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96915PP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96921JI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G96971EN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97213ID", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G97436XI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97585KM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97644GG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G97657WO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97777ZK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97808FL", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G97852WM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G97906UF", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G98126OX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98166ZJ", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G98200VV", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G98308VA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98319WB", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G98393IW", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G98417SQ", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G98473NJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98518WL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98654DA", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G98689EK", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G98698LI", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G98925GS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98977CH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99041WC", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G99041XF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99069BG", "type": "O-linked", "subtype": "Core 1" }, { "glytoucan_ac": "G99281CN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99372JL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99448MJ", "type": "O-linked", "subtype": "Core 2" } ], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }