{ "uniprot_canonical_ac": "Q5I0I4-1", "uniprot_ac": "Q5I0I4", "uniprot_id": "DMAC2_RAT", "mass": { "chemical_mass": 28508.0, "monoisotopic_mass": 28508.0 }, "refseq": { "ac": "NP_001009705", "name": "distal membrane-arm assembly complex protein 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009705" }, "gene_names": [ { "name": "Dmac2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5I0I4", "id": "Q5I0I4" }, { "name": "Atp5sl", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009705", "id": "NP_001009705" }, { "name": "Atp5sl", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q5I0I4", "id": "Q5I0I4" }, { "name": "Dmac2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009705", "id": "NP_001009705" } ], "protein_names": [ { "name": "Distal membrane-arm assembly complex protein 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q5I0I4" }, { "name": "ATP synthase subunit s-like protein; ATP5S-like; distal membrane arm assembly complex 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009705", "id": "NP_001009705" }, { "name": "ATP synthase subunit s-like protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5I0I4" }, { "name": "distal membrane-arm assembly complex protein 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009705", "id": "NP_001009705" } ], "function": [ { "annotation": "Required for the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Involved in the assembly of the distal region of complex I.", "evidence": [ { "database": "UniProtKB", "id": "Q5I0I4", "url": "https://www.uniprot.org/uniprot/Q5I0I4#function" }, { "database": "UniProtKB", "id": "Q9NW81", "url": "https://www.uniprot.org/uniprot/Q9NW81#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q5I0I4", "url": "https://www.uniprot.org/uniprot/Q5I0I4" } ], "common_name": "Rat" } ], "gene": [ { "name": "Dmac2", "url": "https://www.uniprot.org/uniprot/Q5I0I4", "locus": { "chromosome": "1", "start_pos": 81134812, "end_pos": 81128857, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000020596", "url": "https://www.ensembl.org/id/ENSRNOG00000020596" } ] } } ], "crossref": [ { "id": "ENSRNOG00000020596", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000020596", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "361520", "url": "https://www.ncbi.nlm.nih.gov/gene/361520", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR032675", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032675", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:361520", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:361520", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "QCQITAT", "url": "https://omabrowser.org/oma/group/QCQITAT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3148116at2759", "url": "http://www.orthodb.org/?query=3148116at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PR_Q5I0I4", "url": "http://purl.obolibrary.org/obo/PR_Q5I0I4", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001009705", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001009705", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1549698", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1549698", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "Q5I0I4", "url": "https://www.uniprot.org/uniprot/Q5I0I4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5I0I4-1", "url": "https://www.uniprot.org/uniprot/Q5I0I4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAPRAFLHLGAREWHGRARGTHSMSGLATPDSNREKKRTLLQFLSDHFHDVQTLREYLLQKQISKVSMENRSYRKIQERYGPYITGAQFILKQGGAVKFQGRDWIRPNDRGHSIAELQKVPVEAVDASGCAINYQGLSNLLPLKELQFLSLQRCPNLDDWCLSRLYLLAGSLQELSLAGCPRISERGLACLHHLQNLRRLDISDLPAVSHPGLTQILVEEMLPHCEVLGVDWAKSLKLGPDDQPPDTSSPLSS", "length": 254, "header": "sp|Q5I0I4-1|DMAC2_RAT Isoform 1 of Distal membrane-arm assembly complex protein 2 OS=Rattus norvegicus OX=10116 GN=Dmac2 PE=2 SV=1 CANONICAL=Q5I0I4-1" }, "isoforms": [ { "isoform_ac": "Q5I0I4-1", "url": "", "sequence": { "sequence": "MAAPRAFLHLGAREWHGRARGTHSMSGLATPDSNREKKRTLLQFLSDHFHDVQTLREYLLQKQISKVSMENRSYRKIQERYGPYITGAQFILKQGGAVKFQGRDWIRPNDRGHSIAELQKVPVEAVDASGCAINYQGLSNLLPLKELQFLSLQRCPNLDDWCLSRLYLLAGSLQELSLAGCPRISERGLACLHHLQNLRRLDISDLPAVSHPGLTQILVEEMLPHCEVLGVDWAKSLKLGPDDQPPDTSSPLSS", "length": 254, "header": "sp|Q5I0I4-1|DMAC2_RAT Isoform 1 of Distal membrane-arm assembly complex protein 2 OS=Rattus norvegicus OX=10116 GN=Dmac2 PE=2 SV=1 CANONICAL=Q5I0I4-1" }, "locus": { "chromosome": "1", "start_pos": 81133723, "end_pos": 81128883, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000027960", "url": "https://www.ensembl.org/id/ENSRNOT00000027960" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000027960", "url": "https://www.ensembl.org/id/ENSRNOP00000027960" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 250, "end_pos": 250, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q5I0I4", "url": "https://www.uniprot.org/uniprot/Q5I0I4" } ], "site_lbl": "Ser250" } ], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:361520", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:361520", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9D7K5-1", "protein_name": "Distal membrane-arm assembly complex protein 2", "gene_name": "Dmac2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAAPRAVLHLGAREWNGRARRIHGMSELVTPDSSREKKRTLLQFLSDHFQDIQTLREYLLQKQISKVNRENRSFTNIQEKYGPYVAGAVFILKQGGAVKFQDKEEWIRPNNRSHFLAEIQKFQNVPVEAVDASGCAINYQGLSNLLPLKELRSLSLQRCPNLDDWCLSRLYLLAGSLQELSLAGCPRISERGLACLHHLQNLRRLDISDLPAVSHPGLTQILVEEMLPHCEVLGADWAQNLKLEPDKQPPDTSTPLSS", "length": 258 }, "evidence": [ { "id": "45239526", "url": "http://www.informatics.jax.org/homology/45239526", "database": "MGI" }, { "id": "Q5I0I4", "url": "https://omabrowser.org/oma/group/Q5I0I4/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9NW81-1", "protein_name": "Distal membrane-arm assembly complex protein 2", "gene_name": "DMAC2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAAPWASLRLVAPMWNGRIRGIHRLGAAVAPEGNQKKKRTILQFLTNYFYDVEALRDYLLQREMYKVHEKNRSYTWLEKQHGPYGAGAFFILKQGGAVKFRDKEWIRPDKYGHFSQEFWNFCEVPVEAVDAGDCDINYEGLDNLLRLKELQSLSLQRCCHVDDWCLSRLYPLADSLQELSLAGCPRISERGLACLHHLQNLRRLDISDLPAVSNPGLTQILVEEMLPNCEVVGVDWAEGLKSGPEEQPRDTASPVPA", "length": 257 }, "evidence": [ { "id": "45239526", "url": "http://www.informatics.jax.org/homology/45239526", "database": "MGI" }, { "id": "Q5I0I4", "url": "https://omabrowser.org/oma/group/Q5I0I4/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "mitochondrial respiratory chain complex I assembly", "id": "GO:0032981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032981", "evidence": [ { "database": "UniProtKB", "id": "Q5I0I4", "url": "https://www.uniprot.org/uniprot/Q5I0I4" } ], "pmid": "" }, { "name": "SCF-dependent proteasomal ubiquitin-dependent protein catabolic process", "id": "GO:0031146", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031146", "evidence": [ { "database": "UniProtKB", "id": "Q5I0I4", "url": "https://www.uniprot.org/uniprot/Q5I0I4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "SCF ubiquitin ligase complex", "id": "GO:0019005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019005", "evidence": [ { "database": "UniProtKB", "id": "Q5I0I4", "url": "https://www.uniprot.org/uniprot/Q5I0I4" } ], "pmid": "" }, { "name": "mitochondrial respiratory chain complex I", "id": "GO:0005747", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005747", "evidence": [ { "database": "UniProtKB", "id": "Q5I0I4", "url": "https://www.uniprot.org/uniprot/Q5I0I4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 71, "end_pos": 73, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }