{ "uniprot_canonical_ac": "Q5GAM9-1", "uniprot_ac": "Q5GAM9", "uniprot_id": "RNS11_MOUSE", "mass": { "chemical_mass": 20883.0, "monoisotopic_mass": 20883.0 }, "refseq": { "ac": "NP_001011877", "name": "putative inactive ribonuclease 11 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001011877" }, "gene_names": [ { "name": "Rnase11", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5GAM9", "id": "Q5GAM9" }, { "name": "Raj1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001011877", "id": "NP_001011877" }, { "name": "Rnase11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001011877", "id": "NP_001011877" } ], "protein_names": [ { "name": "Putative inactive ribonuclease 11", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q5GAM9" }, { "name": "RNase 11", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5GAM9" }, { "name": "putative inactive ribonuclease 11 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001011877", "id": "NP_001011877" }, { "name": "putative inactive ribonuclease 11; ribonuclease A j1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001011877", "id": "NP_001011877" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q5GAM9", "url": "https://www.uniprot.org/uniprot/Q5GAM9" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Rnase11", "url": "https://www.uniprot.org/uniprot/Q5GAM9", "locus": { "chromosome": "14", "start_pos": 51286908, "end_pos": 51287620, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000059648", "url": "https://www.ensembl.org/id/ENSMUSG00000059648" } ] } } ], "crossref": [ { "id": "ENSMUSG00000059648", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000059648", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "497113", "url": "https://www.ncbi.nlm.nih.gov/gene/497113", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001427", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001427", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:497113", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:497113", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "3528583", "url": "http://www.informatics.jax.org/marker/MGI:3528583", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "CKCGQNL", "url": "https://omabrowser.org/oma/group/CKCGQNL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5193673at2759", "url": "http://www.orthodb.org/?query=5193673at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11437", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11437", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11437:SF22", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11437:SF22", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PR_Q5GAM9", "url": "http://purl.obolibrary.org/obo/PR_Q5GAM9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001011877", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001011877", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q5GAM9", "url": "https://www.uniprot.org/uniprot/Q5GAM9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5GAM9-1", "url": "https://www.uniprot.org/uniprot/Q5GAM9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAVFLLLLALGLLLAKPSESRMKGTTEQFSQEEMQPAAKQTLEESANSTLSDKNTGLSISKHVMSATPLTPRRLSFIIPKGNTMRDGRNCVNSLRVWRTEVDGNASCQLGNDFIHGSMDVSLRIPKATRGKCEQTPKPSSSGSLGLERTTCKVLAGHQCLRSHEHSITSLKKILTVLASNSLMSWLVSGCKL", "length": 192, "header": "sp|Q5GAM9-1|RNS11_MOUSE Isoform 1 of Putative inactive ribonuclease 11 OS=Mus musculus OX=10090 GN=Rnase11 PE=2 SV=1 CANONICAL=Q5GAM9-1" }, "isoforms": [ { "isoform_ac": "Q5GAM9-1", "url": "", "sequence": { "sequence": "MAVFLLLLALGLLLAKPSESRMKGTTEQFSQEEMQPAAKQTLEESANSTLSDKNTGLSISKHVMSATPLTPRRLSFIIPKGNTMRDGRNCVNSLRVWRTEVDGNASCQLGNDFIHGSMDVSLRIPKATRGKCEQTPKPSSSGSLGLERTTCKVLAGHQCLRSHEHSITSLKKILTVLASNSLMSWLVSGCKL", "length": 192, "header": "sp|Q5GAM9-1|RNS11_MOUSE Isoform 1 of Putative inactive ribonuclease 11 OS=Mus musculus OX=10090 GN=Rnase11 PE=2 SV=1 CANONICAL=Q5GAM9-1" }, "locus": { "chromosome": "14", "start_pos": 51287552, "end_pos": 51286977, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000076106", "url": "https://www.ensembl.org/id/ENSMUST00000076106" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000075472", "url": "https://www.ensembl.org/id/ENSMUSP00000075472" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 104, "start_aa": "Asn", "end_pos": 104, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn104", "evidence": [ { "id": "Q5GAM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5GAM9#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 47, "start_aa": "Asn", "end_pos": 47, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn47", "evidence": [ { "id": "Q5GAM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5GAM9#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "The ribonuclease A superfamily of mammals and birds: identifying new members and tracing evolutionary histories.", "journal": "Genomics", "date": "2005", "authors": "Cho S, Beintema JJ, Zhang J", "evidence": [ { "database": "UniProtKB", "id": "Q5GAM9", "url": "https://www.uniprot.org/uniprot/Q5GAM9" } ], "reference": [ { "type": "PubMed", "id": "15676279", "url": "https://glygen.org/publication/PubMed/15676279" } ] } ], "pathway": [ { "id": "mmu:497113", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:497113", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q5GAL9-1", "protein_name": "Ribonuclease, RNase A family, 11 (Non-active)", "gene_name": "Rnase11", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAAFLLLLVLGLLLVEPSESKTKGAREQFSQEETRSAAKQTPEESTNSTLSDENISLGISRHVMSAPPRTSRRLSFVIPKRNTVRNGRDCVNSPSVWRTDVEVNESCQLGNNFIHSSMDVSHGIPKATSGKCERTPNLRYCDSLGLECTMCKVLAGHQCPRYHEHRITSLKRILTVLTSHSLMSWLVTGC", "length": 190 }, "evidence": [ { "id": "45243487", "url": "http://www.informatics.jax.org/homology/45243487", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8TAA1-1", "protein_name": "Probable ribonuclease 11", "gene_name": "RNASE11", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "METFPLLLLSLGLVLAEASESTMKIIKEEFTDEEMQYDMAKSGQEKQTIEILMNPILLVKNTSLSMSKDDMSSTLLTFRSLHYNDPKGNSSGNDKECCNDMTVWRKVSEANGSCKWSNNFIRSSTEVMRRVHRAPSCKFVQNPGISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWLVCGSKL", "length": 199 }, "evidence": [ { "id": "45243487", "url": "http://www.informatics.jax.org/homology/45243487", "database": "MGI" }, { "id": "Q5GAM9", "url": "https://omabrowser.org/oma/group/Q5GAM9/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q5GAM9", "url": "https://www.uniprot.org/uniprot/Q5GAM9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "defense response to Gram-positive bacterium", "id": "GO:0050830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050830", "evidence": [ { "database": "UniProtKB", "id": "Q5GAM9", "url": "https://www.uniprot.org/uniprot/Q5GAM9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "nucleic acid binding", "id": "GO:0003676", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003676", "evidence": [ { "database": "UniProtKB", "id": "Q5GAM9", "url": "https://www.uniprot.org/uniprot/Q5GAM9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 104, "end_pos": 106, "annotation": "n_glycosylation_sequon" }, { "start_pos": 47, "end_pos": 49, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }