{ "uniprot_canonical_ac": "Q5G865-1", "uniprot_ac": "Q5G865", "uniprot_id": "DFA24_MOUSE", "mass": { "chemical_mass": 10327.0, "monoisotopic_mass": 10327.0 }, "refseq": { "ac": "NP_001019396", "name": "alpha-defensin 24 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019396" }, "gene_names": [ { "name": "Defa24", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5G865", "id": "Q5G865" }, { "name": "Defa24", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019396", "id": "NP_001019396" }, { "name": "Defcr24", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019396", "id": "NP_001019396" }, { "name": "Defcr24", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q5G865", "id": "Q5G865" } ], "protein_names": [ { "name": "Alpha-defensin 24", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q5G865" }, { "name": "Defensin-related cryptdin-24", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5G865" }, { "name": "alpha-defensin 24 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019396", "id": "NP_001019396" }, { "name": "defensin-related cryptdin-24; alpha-defensin 24", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019396", "id": "NP_001019396" } ], "function": [ { "annotation": "May have microbicidal activities.", "evidence": [ { "database": "UniProtKB", "id": "Q5G865", "url": "https://www.uniprot.org/uniprot/Q5G865#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q5G865", "url": "https://www.uniprot.org/uniprot/Q5G865" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Defa24", "url": "https://www.uniprot.org/uniprot/Q5G865", "locus": { "chromosome": "8", "start_pos": 22225487, "end_pos": 22224510, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000064213", "url": "https://www.ensembl.org/id/ENSMUSG00000064213" } ] } } ], "crossref": [ { "id": "ENSMUSG00000064213", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000064213", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "503491", "url": "https://www.ncbi.nlm.nih.gov/gene/503491", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002366", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002366", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006080", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006080", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006081", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006081", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016327", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016327", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:503491", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:503491", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "3630383", "url": "http://www.informatics.jax.org/marker/MGI:3630383", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "CICTRGI", "url": "https://omabrowser.org/oma/group/CICTRGI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4845046at2759", "url": "http://www.orthodb.org/?query=4845046at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11876", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11876", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11876:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11876:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00323", "url": "http://pfam.xfam.org/family/PF00323", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00879", "url": "http://pfam.xfam.org/family/PF00879", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q5G865", "url": "http://purl.obolibrary.org/obo/PR_Q5G865", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-1461973", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1461973", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-1462054", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1462054", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001019396", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019396", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q5G865", "url": "https://www.uniprot.org/uniprot/Q5G865", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5G865-1", "url": "https://www.uniprot.org/uniprot/Q5G865-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKTLILLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGASLQEESLRDLVCYCRARGCKGRERMNGTCSKGHLLYMLCCR", "length": 93, "header": "sp|Q5G865-1|DFA24_MOUSE Isoform 1 of Alpha-defensin 24 OS=Mus musculus OX=10090 GN=Defa24 PE=3 SV=1 CANONICAL=Q5G865-1" }, "isoforms": [ { "isoform_ac": "Q5G865-1", "url": "", "sequence": { "sequence": "MKTLILLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGASLQEESLRDLVCYCRARGCKGRERMNGTCSKGHLLYMLCCR", "length": 93, "header": "sp|Q5G865-1|DFA24_MOUSE Isoform 1 of Alpha-defensin 24 OS=Mus musculus OX=10090 GN=Defa24 PE=3 SV=1 CANONICAL=Q5G865-1" }, "locus": { "chromosome": "8", "start_pos": 22225390, "end_pos": 22224553, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000080533", "url": "https://www.ensembl.org/id/ENSMUST00000080533" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000079376", "url": "https://www.ensembl.org/id/ENSMUSP00000079376" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Rapid evolution and diversification of mammalian alpha-defensins as revealed by comparative analysis of rodent and primate genes.", "journal": "Physiol. Genomics", "date": "2004", "authors": "Zhang G., Hughes A.L., Patil A.", "evidence": [ { "database": "UniProtKB", "id": "Q5G865", "url": "https://www.uniprot.org/uniprot/Q5G865" } ], "reference": [ { "type": "PubMed", "id": "15494476", "url": "https://glygen.org/publication/PubMed/15494476" } ] } ], "pathway": [ { "id": "mmu:503491", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:503491", "resource": "KEGG Pathway" }, { "id": "R-MMU-1461973", "name": "Defensins", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1461973", "resource": "Reactome", "description": "Defensins" }, { "id": "R-MMU-1462054", "name": "Alpha-defensins", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1462054", "resource": "Reactome", "description": "Alpha-defensins" }, { "id": "R-MMU-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" } ], "orthologs": [ { "uniprot_canonical_ac": "P59665-1", "protein_name": "Neutrophil defensin 1", "gene_name": "DEFA1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC", "length": 94 }, "evidence": [ { "id": "45241009", "url": "http://www.informatics.jax.org/homology/45241009", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P59666-1", "protein_name": "Neutrophil defensin 3", "gene_name": "DEFA3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC", "length": 94 }, "evidence": [ { "id": "45241009", "url": "http://www.informatics.jax.org/homology/45241009", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q01523-1", "protein_name": "Defensin alpha 5", "gene_name": "DEFA5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR", "length": 94 }, "evidence": [ { "id": "45241009", "url": "http://www.informatics.jax.org/homology/45241009", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q01524-1", "protein_name": "Defensin-6", "gene_name": "DEFA6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL", "length": 100 }, "evidence": [ { "id": "45241009", "url": "http://www.informatics.jax.org/homology/45241009", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q4JEI9-1", "protein_name": "Enteric defensin alpha 5", "gene_name": "Defa24", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKTLVLLSALVLLALQVQAEPTPKTDEGTKTDEQPGKEDQVVSVSIEGQGDPAFQDAVLRDLKCFCRAKSCNWGEGIMGICNKRYGSLILCCR", "length": 93 }, "evidence": [ { "id": "45241009", "url": "http://www.informatics.jax.org/homology/45241009", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "Q5G865", "url": "https://www.uniprot.org/uniprot/Q5G865" } ], "pmid": "" }, { "name": "secretory granule", "id": "GO:0030141", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030141", "evidence": [ { "database": "UniProtKB", "id": "Q5G865", "url": "https://www.uniprot.org/uniprot/Q5G865" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "Q5G865", "url": "https://www.uniprot.org/uniprot/Q5G865" } ], "pmid": "" }, { "name": "midbody", "id": "GO:0030496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030496", "evidence": [ { "database": "UniProtKB", "id": "Q5G865", "url": "https://www.uniprot.org/uniprot/Q5G865" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "antibacterial humoral response", "id": "GO:0019731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019731", "evidence": [ { "database": "UniProtKB", "id": "Q5G865", "url": "https://www.uniprot.org/uniprot/Q5G865" } ], "pmid": "" }, { "name": "defense response to Gram-negative bacterium", "id": "GO:0050829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050829", "evidence": [ { "database": "UniProtKB", "id": "Q5G865", "url": "https://www.uniprot.org/uniprot/Q5G865" } ], "pmid": "" }, { "name": "defense response to Gram-positive bacterium", "id": "GO:0050830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050830", "evidence": [ { "database": "UniProtKB", "id": "Q5G865", "url": "https://www.uniprot.org/uniprot/Q5G865" } ], "pmid": "" }, { "name": "antimicrobial humoral immune response mediated by antimicrobial peptide", "id": "GO:0061844", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061844", "evidence": [ { "database": "UniProtKB", "id": "Q5G865", "url": "https://www.uniprot.org/uniprot/Q5G865" } ], "pmid": "" }, { "name": "cellular response to lipopolysaccharide", "id": "GO:0071222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071222", "evidence": [ { "database": "UniProtKB", "id": "Q5G865", "url": "https://www.uniprot.org/uniprot/Q5G865" } ], "pmid": "" }, { "name": "innate immune response in mucosa", "id": "GO:0002227", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002227", "evidence": [ { "database": "UniProtKB", "id": "Q5G865", "url": "https://www.uniprot.org/uniprot/Q5G865" } ], "pmid": "" }, { "name": "perturbation of plasma membrane integrity in another organism", "id": "GO:0051673", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051673", "evidence": [ { "database": "UniProtKB", "id": "Q5G865", "url": "https://www.uniprot.org/uniprot/Q5G865" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "Q5G865", "url": "https://www.uniprot.org/uniprot/Q5G865" } ], "pmid": "" }, { "name": "pore-forming activity", "id": "GO:0140911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140911", "evidence": [ { "database": "UniProtKB", "id": "Q5G865", "url": "https://www.uniprot.org/uniprot/Q5G865" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 78, "end_pos": 80, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }