{ "uniprot_canonical_ac": "Q5FVJ8-1", "uniprot_ac": "Q5FVJ8", "uniprot_id": "SENP8_RAT", "mass": { "chemical_mass": 24728.0, "monoisotopic_mass": 24728.0 }, "refseq": { "ac": "NP_001012355", "name": "sentrin-specific protease 8", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012355" }, "gene_names": [ { "name": "Senp8", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5FVJ8", "id": "Q5FVJ8" }, { "name": "Senp8", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012355", "id": "NP_001012355" } ], "protein_names": [ { "name": "Sentrin-specific protease 8", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q5FVJ8" }, { "name": "3.4.22.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5FVJ8" }, { "name": "Deneddylase-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5FVJ8" }, { "name": "NEDD8-specific protease 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5FVJ8" }, { "name": "Sentrin/SUMO-specific protease SENP8", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5FVJ8" }, { "name": "deneddylase-1; NEDD8-specific protease 1; sentrin/SUMO-specific protease SENP8; SUMO/sentrin specific protease family member 8; SUMO/sentrin specific peptidase 8; Sumo1/sentrin/SMT3 specific peptidase 8; SUMO/sentrin specific peptidase family member 8; SUMO/sentrin peptidase family member, NEDD8 specific", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012355", "id": "NP_001012355" }, { "name": "sentrin-specific protease 8", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012355", "id": "NP_001012355" } ], "function": [ { "annotation": "Deneddylating enzyme SENP8 regulates neuronal development.", "evidence": [ { "database": "RefSeq", "id": "NP_001012355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012355" }, { "database": "PubMed", "id": "36847487", "url": "https://glygen.org/publication/PubMed/36847487" } ] }, { "annotation": "Protease that catalyzes two essential functions in the NEDD8 pathway: processing of full-length NEDD8 to its mature form and deconjugation of NEDD8 from targeted proteins such as cullins or p53.", "evidence": [ { "database": "UniProtKB", "id": "Q5FVJ8", "url": "https://www.uniprot.org/uniprot/Q5FVJ8#function" }, { "database": "UniProtKB", "id": "Q96LD8", "url": "https://www.uniprot.org/uniprot/Q96LD8#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q5FVJ8", "url": "https://www.uniprot.org/uniprot/Q5FVJ8" } ], "common_name": "Rat" } ], "gene": [ { "name": "Senp8", "url": "https://www.uniprot.org/uniprot/Q5FVJ8", "locus": { "chromosome": "8", "start_pos": 60121714, "end_pos": 60148928, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000011595", "url": "https://www.ensembl.org/id/ENSRNOG00000011595" } ] } } ], "crossref": [ { "id": "ENSRNOG00000011595", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000011595", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "315723", "url": "https://www.ncbi.nlm.nih.gov/gene/315723", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003653", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003653", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038765", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038765", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044613", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044613", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:315723", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:315723", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "GFYFEYL", "url": "https://omabrowser.org/oma/group/GFYFEYL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "49695at2759", "url": "http://www.orthodb.org/?query=49695at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46468", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46468", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46468:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46468:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02902", "url": "http://pfam.xfam.org/family/PF02902", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q5FVJ8", "url": "http://purl.obolibrary.org/obo/PR_Q5FVJ8", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-5689603", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5689603", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-8951664", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8951664", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001012355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012355", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1309955", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1309955", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "Q5FVJ8", "url": "https://www.uniprot.org/uniprot/Q5FVJ8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5FVJ8-1", "url": "https://www.uniprot.org/uniprot/Q5FVJ8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDPVVLSYMDSLLRQSDVSLLDPPNWLNDHIIGFAFEYFASSQFHDCSDHVCFISPEVTQFIKCTSSPAEIAMFLEPLDLPHKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSIHAKQVAEKLKAFLGSKGDKLVFVEEKAPAQQNSYDCGMYVICNTEALCQNLFRRQPESPLQLLTPTYITKKRGEWKDLIARLAKKNRSSY", "length": 217, "header": "sp|Q5FVJ8-1|SENP8_RAT Isoform 1 of Sentrin-specific protease 8 OS=Rattus norvegicus OX=10116 GN=Senp8 PE=2 SV=1 CANONICAL=Q5FVJ8-1" }, "isoforms": [ { "isoform_ac": "Q5FVJ8-1", "url": "", "sequence": { "sequence": "MDPVVLSYMDSLLRQSDVSLLDPPNWLNDHIIGFAFEYFASSQFHDCSDHVCFISPEVTQFIKCTSSPAEIAMFLEPLDLPHKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSIHAKQVAEKLKAFLGSKGDKLVFVEEKAPAQQNSYDCGMYVICNTEALCQNLFRRQPESPLQLLTPTYITKKRGEWKDLIARLAKKNRSSY", "length": 217, "header": "sp|Q5FVJ8-1|SENP8_RAT Isoform 1 of Sentrin-specific protease 8 OS=Rattus norvegicus OX=10116 GN=Senp8 PE=2 SV=1 CANONICAL=Q5FVJ8-1" }, "locus": { "chromosome": "8", "start_pos": 60136345, "end_pos": 60135695, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000111287", "url": "https://www.ensembl.org/id/ENSRNOT00000111287" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000086922", "url": "https://www.ensembl.org/id/ENSRNOP00000086922" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Deneddylating enzyme SENP8 regulates neuronal development.", "journal": "Journal of neurochemistry", "date": "2023-02-27", "authors": "Song Jae-Man, Kang Minji, Lee Seungha, Kim Jungho, Park Sunha, Park Da-Ha, Lee Sanghyeon, Suh Young Ho", "evidence": [ { "database": "RefSeq", "id": "NP_001012355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012355" } ], "reference": [ { "type": "PubMed", "id": "36847487", "url": "https://glygen.org/publication/PubMed/36847487" } ] } ], "pathway": [ { "id": "rno:315723", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:315723", "resource": "KEGG Pathway" }, { "id": "R-RNO-5689603", "name": "UCH proteinases", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5689603", "resource": "Reactome", "description": "UCH proteinases" }, { "id": "R-RNO-8951664", "name": "Neddylation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8951664", "resource": "Reactome", "description": "Neddylation" } ], "orthologs": [ { "uniprot_canonical_ac": "Q96LD8-1", "protein_name": "Sentrin-specific protease 8", "gene_name": "SENP8", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK", "length": 212 }, "evidence": [ { "id": "45239146", "url": "http://www.informatics.jax.org/homology/45239146", "database": "MGI" }, { "id": "Q5FVJ8", "url": "https://omabrowser.org/oma/group/Q5FVJ8/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9D2Z4-1", "protein_name": "Sentrin-specific protease 8", "gene_name": "Senp8", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVCFISPEVTQFIKCTSSPAEIAMFLEPLDLPHKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSIHAKQVAEKLKAFLGSKGDKLVFVEEKAPAQENSYDCGMYVICNTEALCQSLFRRQPESPLQLLTPTYITKKRGEWKDLIARLAKKNEVATEECS", "length": 221 }, "evidence": [ { "id": "45239146", "url": "http://www.informatics.jax.org/homology/45239146", "database": "MGI" }, { "id": "Q5FVJ8", "url": "https://omabrowser.org/oma/group/Q5FVJ8/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "deNEDDylase activity", "id": "GO:0019784", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019784", "evidence": [ { "database": "UniProtKB", "id": "Q5FVJ8", "url": "https://www.uniprot.org/uniprot/Q5FVJ8" } ], "pmid": "" }, { "name": "cysteine-type peptidase activity", "id": "GO:0008234", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008234", "evidence": [ { "database": "UniProtKB", "id": "Q5FVJ8", "url": "https://www.uniprot.org/uniprot/Q5FVJ8" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "protein deneddylation", "id": "GO:0000338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000338", "evidence": [ { "database": "UniProtKB", "id": "Q5FVJ8", "url": "https://www.uniprot.org/uniprot/Q5FVJ8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 213, "end_pos": 215, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-RNO-5690808", "name": "UCHL3, SENP8 cleave NEDD8", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-RNO-6782654" ], "enzyme_list": [ "Q5FVJ8-1", "Q91Y78-1" ], "evidence": [ { "id": "R-RNO-5690808", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5690808" } ] }, { "id": "R-RNO-8951644", "name": "Release of mature NEDD8", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5FVJ8-1", "Q91Y78-1" ], "evidence": [ { "id": "R-RNO-8951644", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8951644" } ] } ], "reaction_participants": [ { "participant_id": "R-RNO-6782654", "participant_name": "Nedd8 [cytosol]", "crossref": [ { "id": "Q71UE8", "database": "UniProt", "url": "" }, { "id": "NP_620233.1", "database": "RefSeq", "url": "" }, { "id": "3158", "database": "RGD", "url": "" }, { "id": "Q71UE8", "database": "PRO", "url": "" }, { "id": "ENSRNOT00000064916", "database": "Ensembl", "url": "" }, { "id": "ENSRNOP00000061284", "database": "Ensembl", "url": "" }, { "id": "ENSRNOG00000019895", "database": "Ensembl", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "Q5FVJ8", "gene_name": "Senp8", "activity": [ { "ec_number": "3.4.22.-", "activity": "", "evidence": [ { "id": "Q5FVJ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5FVJ8" } ] } ] }, { "uniprot_ac": "Q91Y78", "gene_name": "Uchl3", "activity": [ { "ec_number": "3.4.19.12", "activity": "Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).", "evidence": [ { "id": "Q91Y78", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Y78" } ] }, { "ec_number": "3.4.19.12", "activity": "", "evidence": [ { "id": "Q91Y78", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Y78" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }