{ "uniprot_canonical_ac": "Q5F201-1", "uniprot_ac": "Q5F201", "uniprot_id": "CFA52_MOUSE", "mass": { "chemical_mass": 68240.0, "monoisotopic_mass": 68240.0 }, "refseq": { "ac": "NP_082239", "name": "cilia- and flagella-associated protein 52", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082239" }, "gene_names": [ { "name": "Cfap52", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5F201", "id": "Q5F201" }, { "name": "1700019F09Rik; 4933417B11Rik; Wdr16; WDRPUH", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082239", "id": "NP_082239" }, { "name": "Cfap52", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082239", "id": "NP_082239" }, { "name": "Wdr16", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q5F201", "id": "Q5F201" } ], "protein_names": [ { "name": "Cilia- and flagella-associated protein 52", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q5F201" }, { "name": "WD repeat-containing protein 16", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5F201" }, { "name": "WD40-repear protein upregulated in HCC; WD repeat-containing protein 16; WD repeat domain 16", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082239", "id": "NP_082239" }, { "name": "cilia- and flagella-associated protein 52", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082239", "id": "NP_082239" } ], "function": [ { "annotation": "Human WDRPUH is a novel WD-repeat-containing protein involved in cell proliferation.", "evidence": [ { "database": "RefSeq", "id": "NP_082239", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082239" }, { "database": "PubMed", "id": "15967112", "url": "https://glygen.org/publication/PubMed/15967112" } ] }, { "annotation": "Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia axoneme (By similarity). Important for proper ciliary and flagellar beating. May act in cooperation with CFAP45 and axonemal dynein subunit DNAH11. May play a role in cell growth and/or survival (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q5F201", "url": "https://www.uniprot.org/uniprot/Q5F201#function" }, { "database": "UniProtKB", "id": "Q8N1V2", "url": "https://www.uniprot.org/uniprot/Q8N1V2#function" }, { "database": "UniProtKB", "id": "E1BKF9", "url": "https://www.uniprot.org/uniprot/E1BKF9#function" } ] }, { "annotation": "Wdr16 is most abundantly expressed in tissues rich in highly ciliated cells, such as olfactory sensory neurons, and is predicted to be important to cilia.", "evidence": [ { "database": "RefSeq", "id": "NP_082239", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082239" }, { "database": "PubMed", "id": "17971504", "url": "https://glygen.org/publication/PubMed/17971504" } ] } ], "disease": [ { "disease_id": "DOID:0050545", "recommended_name": { "id": "DOID:0050545", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050545", "name": "visceral heterotaxy", "description": "A physical disorder characterized by the abnormal distribution of the major visceral organs within the chest and abdomen." }, "synonyms": [ { "id": "DOID:0050545", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050545", "name": "heterotaxia", "description": "" }, { "id": "DOID:0050545", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050545", "name": "situs ambiguus", "description": "" }, { "id": "MONDO:0011546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011546", "name": "heterotaxy, visceral, 2, autosomal", "description": "" }, { "id": "MONDO:0011546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011546", "name": "DTGA2", "description": "" }, { "id": "MONDO:0011546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011546", "name": "heterotaxy, visceral, 2, autosomal", "description": "" }, { "id": "MONDO:0011546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011546", "name": "transposition of the great arteries, dextro-looped 2", "description": "" }, { "id": "MONDO:0011546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011546", "name": "HTX2", "description": "" }, { "id": "MONDO:0011546", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011546", "name": "Htx", "description": "" }, { "id": "MONDO:0011659", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011659", "name": "heterotaxy, visceral, 3, autosomal", "description": "" }, { "id": "MONDO:0011659", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011659", "name": "HTX3", "description": "" }, { "id": "MONDO:0011659", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011659", "name": "heterotaxy, visceral, 3, autosomal", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "heterotaxy, visceral, 1, X-linked", "description": "X-linked visceral heterotaxy type 1 is a very rare form of heterotaxy that has only been reported in a few families. Heterotaxy is the right/left transposition of thoracic and/or abdominal organs. This condition is caused by mutations in the ZIC3 gene, is inherited in an X-linked recessive fashion, and is usually seen in males. Physical features include heart abnormalities such as dextrocardia, transposition of great vessels, ventricular septal defect, patent ductus arteriosus, pulmonic stenosis ; situs inversus, and missing (asplenia) and/or extra spleens (polysplenia).Affected individualscan also experience abnormalities in the development of the midline of the body, which can cause holoprosencephaly, myelomeningocele, urological anomalies, widely spaced eyes (hypertelorism), cleft palate, and abnormalities of the sacral spine and anus. Heterotaxia with recurrent respiratory infections are called primary ciliary dyskinesia." }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "ZIC3 visceral heterotaxy", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "congenital heart defects, nonsyndromic, 1, X-linked, X-linked recessive", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "heterotaxy, visceral, 1, X-linked", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "heterotaxy, visceral, 1, X-linked, X-linked recessive", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "visceral heterotaxy caused by mutation in ZIC3", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "HTX1", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "X-linked visceral heterotaxy 1", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "congenital heart defects, multiple types, 1, X-linked", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "dextrocardia with Other Cardiac malformations", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "heterotaxy, visceral, X-linked", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "laterality, X-linked", "description": "" }, { "id": "MONDO:0010607", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010607", "name": "situs inversus, Complex Cardiac defects, and splenic defects, X-linked", "description": "" }, { "id": "MONDO:0013887", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013887", "name": "heterotaxy, visceral, 6, autosomal", "description": "" }, { "id": "MONDO:0013887", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013887", "name": "heterotaxy, visceral, 6, autosomal", "description": "" }, { "id": "MONDO:0013887", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013887", "name": "heterotaxy, visceral, 6, autosomal recessive", "description": "" }, { "id": "MONDO:0013887", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013887", "name": "HTX6", "description": "" }, { "id": "MONDO:0013403", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013403", "name": "heterotaxy, visceral, 4, autosomal", "description": "Any visceral heterotaxy in which the cause of the disease is a mutation in the ACVR2B gene." }, { "id": "MONDO:0013403", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013403", "name": "ACVR2B visceral heterotaxy", "description": "" }, { "id": "MONDO:0013403", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013403", "name": "heterotaxy, visceral, 4, autosomal", "description": "" }, { "id": "MONDO:0013403", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013403", "name": "visceral heterotaxy caused by mutation in ACVR2B", "description": "" }, { "id": "MONDO:0013403", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013403", "name": "HTX4", "description": "" }, { "id": "MIM:605376", "resource": "MIM", "url": "https://www.omim.org/entry/605376", "name": "Heterotaxy, visceral, 2, autosomal", "description": "Heterotaxy, visceral, 2, autosomal" }, { "id": "MIM:306955", "resource": "MIM", "url": "https://www.omim.org/entry/306955", "name": "Heterotaxy, visceral, 1, X-linked", "description": "Heterotaxy, visceral, 1, X-linked" }, { "id": "MIM:614779", "resource": "MIM", "url": "https://www.omim.org/entry/614779", "name": "Heterotaxy, visceral, 6, autosomal", "description": "Heterotaxy, visceral, 6, autosomal" }, { "id": "MIM:613751", "resource": "MIM", "url": "https://www.omim.org/entry/613751", "name": "Heterotaxy, visceral, 4, autosomal", "description": "Heterotaxy, visceral, 4, autosomal" } ], "evidence": [ { "id": "0050545", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050545" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q5F201", "url": "https://www.uniprot.org/uniprot/Q5F201" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Cfap52", "url": "https://www.uniprot.org/uniprot/Q5F201", "locus": { "chromosome": "11", "start_pos": 67815632, "end_pos": 67856477, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000020904", "url": "https://www.ensembl.org/id/ENSMUSG00000020904" } ] } } ], "crossref": [ { "id": "ENSMUSG00000020904", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000020904", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "71860", "url": "https://www.ncbi.nlm.nih.gov/gene/71860", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001680", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001680", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015943", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015943", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019775", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019775", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036322", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036322", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:71860", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:71860", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1919110", "url": "http://www.informatics.jax.org/marker/MGI:1919110", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "YFPTGVQ", "url": "https://omabrowser.org/oma/group/YFPTGVQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "905838at2759", "url": "http://www.orthodb.org/?query=905838at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13720", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13720", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13720:SF14", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13720:SF14", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00400", "url": "http://pfam.xfam.org/family/PF00400", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q5F201", "url": "http://purl.obolibrary.org/obo/PR_Q5F201", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_082239", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082239", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q5F201", "url": "https://www.uniprot.org/uniprot/Q5F201", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5F201-1", "url": "https://www.uniprot.org/uniprot/Q5F201-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5F201-2", "url": "https://www.uniprot.org/uniprot/Q5F201-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEEQVLPELDVAELELQAVIGFNGHVPNGLKCHPDQEHLIYPLGCTVLIQAINTNEQNFLHGHGNNVSCVTISKEGDYIASGQVTFMGFKADIILWDFKKRELIARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICGSPAAGLNVGNATSVVFSRCRDEMFVTAGNGTIRVWELDLPNRKIWPTECQTGQMKRIVLSTGMADDDSFFYLGTTTGDILKMNPKTKLLADTGPVKDKFSLGVSALRCLKMGGLLVGSGAGLLIFCKSPSYKPIKKVQLQGGITSITLRGEGHQFFVGTEESHIYRVNFTDFKETLIATCHFEAVQDIVFPFGTAELFATCAKKDIRVWHTMSKRELLRITVPNMTCHGIDFMRDGKSIISAWDDGKIRAFAPESGRLMYTINSAHRIGVTAIATTSDCKRIISGGGEGEVRVWQVGCQTQKLEEALKEHKSSVSCIRVKKNNEECVTASTDGTCIIWDLVRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGSVIRELEGSLSGSINGMDITQEGGHFVTGGHDHLVKVWDYNEGEVTHVGVGHSGNIMAMRISPGNQYIVSVSADGAILRWKYPFAS", "length": 620, "header": "sp|Q5F201-1|CFA52_MOUSE Isoform 1 of Cilia- and flagella-associated protein 52 OS=Mus musculus OX=10090 GN=Cfap52 PE=1 SV=1 CANONICAL=Q5F201-1" }, "isoforms": [ { "isoform_ac": "Q5F201-1", "url": "", "sequence": { "sequence": "MEEQVLPELDVAELELQAVIGFNGHVPNGLKCHPDQEHLIYPLGCTVLIQAINTNEQNFLHGHGNNVSCVTISKEGDYIASGQVTFMGFKADIILWDFKKRELIARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICGSPAAGLNVGNATSVVFSRCRDEMFVTAGNGTIRVWELDLPNRKIWPTECQTGQMKRIVLSTGMADDDSFFYLGTTTGDILKMNPKTKLLADTGPVKDKFSLGVSALRCLKMGGLLVGSGAGLLIFCKSPSYKPIKKVQLQGGITSITLRGEGHQFFVGTEESHIYRVNFTDFKETLIATCHFEAVQDIVFPFGTAELFATCAKKDIRVWHTMSKRELLRITVPNMTCHGIDFMRDGKSIISAWDDGKIRAFAPESGRLMYTINSAHRIGVTAIATTSDCKRIISGGGEGEVRVWQVGCQTQKLEEALKEHKSSVSCIRVKKNNEECVTASTDGTCIIWDLVRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGSVIRELEGSLSGSINGMDITQEGGHFVTGGHDHLVKVWDYNEGEVTHVGVGHSGNIMAMRISPGNQYIVSVSADGAILRWKYPFAS", "length": 620, "header": "sp|Q5F201-1|CFA52_MOUSE Isoform 1 of Cilia- and flagella-associated protein 52 OS=Mus musculus OX=10090 GN=Cfap52 PE=1 SV=1 CANONICAL=Q5F201-1" }, "locus": { "chromosome": "11", "start_pos": 67856417, "end_pos": 67815922, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000021287", "url": "https://www.ensembl.org/id/ENSMUST00000021287" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000021287", "url": "https://www.ensembl.org/id/ENSMUSP00000021287" } ] } }, { "isoform_ac": "Q5F201-2", "url": "", "sequence": { "sequence": "MEEQVLPELDVAELELQAVIGFNGHVPNGLKCHPDQEHLIYPLGCTVLIQAINTNEQNFLHGHGNNVSCVTISKEGDYIASGQVTFMGFKADIILWDFKKRELIARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICGSPAAGLNVGNATSVVFSRCRDEMFVTAGNGTIRVWELDLPNRKIWPTECQTGQMKRIVLSTGMADDDSFFYLGTTTGDILKMNPKTKLLADTGPVKDKFSLGVSALRCLKMGGLLVGSGAGLLIFCKSPSYKPIKKVQLQGGITSITLRGEGHQFFVGTEESHIYRVNFTDFKETLIATCHFEAVQDIVFPL", "length": 342, "header": "sp|Q5F201-2|CFA52_MOUSE Isoform 2 of Cilia- and flagella-associated protein 52 OS=Mus musculus OX=10090 GN=Cfap52 PE=1 SV=1 CANONICAL=Q5F201-1" }, "locus": { "chromosome": "11", "start_pos": 67856417, "end_pos": 67829742, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000126766", "url": "https://www.ensembl.org/id/ENSMUST00000126766" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000116496", "url": "https://www.ensembl.org/id/ENSMUSP00000116496" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "WDRPUH, a novel WD-repeat-containing protein, is highly expressed in human hepatocellular carcinoma and involved in cell proliferation.", "journal": "Neoplasia (New York, N.Y.)", "date": "2005", "authors": "Silva FP, Hamamoto R, Nakamura Y, Furukawa Y", "evidence": [ { "database": "RefSeq", "id": "NP_082239", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082239" } ], "reference": [ { "type": "PubMed", "id": "15967112", "url": "https://glygen.org/publication/PubMed/15967112" } ] }, { "title": "Tissue expression patterns identify mouse cilia genes.", "journal": "Physiological genomics", "date": "2008", "authors": "McClintock TS, Glasser CE, Bose SC, Bergman DA", "evidence": [ { "database": "RefSeq", "id": "NP_082239", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082239" } ], "reference": [ { "type": "PubMed", "id": "17971504", "url": "https://glygen.org/publication/PubMed/17971504" } ] } ], "pathway": [ { "id": "mmu:71860", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:71860", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A6HFJ5-1", "protein_name": "Cilia and flagella associated protein 52", "gene_name": "Cfap52", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEEQILPETDVAELELQAVIGFNGHVPNGLKCHPDQEHLVYPLGCTVLIQAINTNEQNFLHGHGNNVSCVTISKEGDYVASGQVTFMGFKADIILWDFKKRELIARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICGSPAAGLNVGNATSVVFSRCRDEMFVTAGNGTIRVWELDLPNRKIWPTECQTGQMKRIVMSSGMADDDSFFYLGTTTGDILKINPKTKLLADTGPMKDKFSLGVSALRCLKMGGLLVGSGAGLLIFCKSPSYKPIKKLQLQGGITSITLRGEGHQFFVGTEESHIYRVNFTDFKETLIATCHFEAVQDIVFPFGTAELFATCAKKDIRVWHTMSKRELLRITVPNMTCHGIDFMRDGKSIISAWDDGKIRAFAPESGRLMYTINSAHRIGVTAIATTSDCKRIISGGGEGEVRVWQIGCQTQKLEEALKEHKSSVSCIRVKKNNEECVTASTDGTCIIWDLVRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGSVIRELEGSLSGSVNGMDITQEGEHFVTGGHDHLIKVWDYNEGEVTHVGVGHSGNIMGIRISPGNQYIVSVSADGAILRWKYPFAS", "length": 620 }, "evidence": [ { "id": "45237883", "url": "http://www.informatics.jax.org/homology/45237883", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8N1V2-1", "protein_name": "Cilia- and flagella-associated protein 52", "gene_name": "CFAP52", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDNKISPEAQVAELELDAVIGFNGHVPTGLKCHPDQEHMIYPLGCTVLIQAINTKEQNFLQGHGNNVSCLAISRSGEYIASGQVTFMGFKADIILWDYKNRELLARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICGSPAAGLNVGNATNVIFSRCRDEMFMTAGNGTIRVWELDLPNRKIWPTECQTGQLKRIVMSIGVDDDDSFFYLGTTTGDILKMNPRTKLLTDVGPAKDKFSLGVSAIRCLKMGGLLVGSGAGLLVFCKSPGYKPIKKIQLQGGITSITLRGEGHQFLVGTEESHIYRVSFTDFKETLIATCHFDAVEDIVFPFGTAELFATCAKKDIRVWHTSSNRELLRITVPNMTCHGIDFMRDGKSIISAWNDGKIRAFAPETGRLMYVINNAHRIGVTAIATTSDCKRVISGGGEGEVRVWQIGCQTQKLEEALKEHKSSVSCIRVKRNNEECVTASTDGTCIIWDLVRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGTVIRELEGSLSGSINGMDITQEGVHFVTGGNDHLVKVWDYNEGEVTHVGVGHSGNITRIRISPGNQYIVSVSADGAILRWKYPYTS", "length": 620 }, "evidence": [ { "id": "45237883", "url": "http://www.informatics.jax.org/homology/45237883", "database": "MGI" }, { "id": "Q5F201", "url": "https://omabrowser.org/oma/group/Q5F201/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "flagellated sperm motility", "id": "GO:0030317", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030317", "evidence": [ { "database": "UniProtKB", "id": "Q5F201", "url": "https://www.uniprot.org/uniprot/Q5F201" } ], "pmid": "" }, { "name": "establishment of left/right asymmetry", "id": "GO:0061966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061966", "evidence": [ { "database": "UniProtKB", "id": "Q5F201", "url": "https://www.uniprot.org/uniprot/Q5F201" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "axoneme", "id": "GO:0005930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005930", "evidence": [ { "database": "UniProtKB", "id": "Q5F201", "url": "https://www.uniprot.org/uniprot/Q5F201" } ], "pmid": "" }, { "name": "axonemal microtubule", "id": "GO:0005879", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005879", "evidence": [ { "database": "UniProtKB", "id": "Q5F201", "url": "https://www.uniprot.org/uniprot/Q5F201" } ], "pmid": "" }, { "name": "9+2 motile cilium", "id": "GO:0097729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097729", "evidence": [ { "database": "UniProtKB", "id": "Q5F201", "url": "https://www.uniprot.org/uniprot/Q5F201" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 160, "end_pos": 162, "annotation": "n_glycosylation_sequon" }, { "start_pos": 179, "end_pos": 181, "annotation": "n_glycosylation_sequon" }, { "start_pos": 318, "end_pos": 320, "annotation": "n_glycosylation_sequon" }, { "start_pos": 374, "end_pos": 376, "annotation": "n_glycosylation_sequon" }, { "start_pos": 66, "end_pos": 68, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }