{ "uniprot_canonical_ac": "Q5EBG6-1", "uniprot_ac": "Q5EBG6", "uniprot_id": "HSPB6_MOUSE", "mass": { "chemical_mass": 17521.0, "monoisotopic_mass": 17521.0 }, "refseq": { "ac": "NP_001012401", "name": "heat shock protein beta-6 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401" }, "gene_names": [ { "name": "Hspb6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5EBG6", "id": "Q5EBG6" }, { "name": "Gm479; Hsp20", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401", "id": "NP_001012401" }, { "name": "Gm479", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q5EBG6", "id": "Q5EBG6" }, { "name": "Hspb6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401", "id": "NP_001012401" } ], "protein_names": [ { "name": "Heat shock protein beta-6", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q5EBG6" }, { "name": "HspB6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5EBG6" }, { "name": "cardiac heat shock protein p20; heat shock protein beta-6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401", "id": "NP_001012401" }, { "name": "heat shock protein beta-6 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401", "id": "NP_001012401" } ], "function": [ { "annotation": "HSP20-mediated cardiomyocyte exosomes improve cardiac function in mice with myocardial infarction by activating Akt signaling pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_001012401", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401" }, { "database": "PubMed", "id": "31210321", "url": "https://glygen.org/publication/PubMed/31210321" } ] }, { "annotation": "Hsp20-S10F mice treated with probenecid had decreased mortality, hypertrophy, TRPV2 expression and molecular parameters of heart failure. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001012401", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401" }, { "database": "PubMed", "id": "32218573", "url": "https://glygen.org/publication/PubMed/32218573" } ] }, { "annotation": "Identification and characterization of a cardiac isoform of p20 associated with beta-adrenergic signaling in adult cardiomyocytes.", "evidence": [ { "database": "RefSeq", "id": "NP_001012401", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401" }, { "database": "PubMed", "id": "14615292", "url": "https://glygen.org/publication/PubMed/14615292" } ] }, { "annotation": "Our study was designed to assess the efficacy of small heat shock proteins B1 (Hsp27) and B6 (Hsp20) as an adjuvant accompanied by HPV16 E7 and hPP10-E7 antigens in tumor mouse model. A major key for successful DNA and protein transfer into cells is the development of delivery systems with high efficiency and low cytotoxicity.", "evidence": [ { "database": "RefSeq", "id": "NP_001012401", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401" }, { "database": "PubMed", "id": "30171788", "url": "https://glygen.org/publication/PubMed/30171788" } ] }, { "annotation": "Recombinant mouse Hsp20 translocates to and interacts with actin cytoskeleton in response to isoproterenol stimulation and prevents ss-agonist-induced apoptosis in adult rat cardiomyocytes.", "evidence": [ { "database": "RefSeq", "id": "NP_001012401", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401" }, { "database": "PubMed", "id": "15105294", "url": "https://glygen.org/publication/PubMed/15105294" } ] }, { "annotation": "Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Seems to have versatile functions in various biological processes. Plays a role in regulating muscle function such as smooth muscle vasorelaxation and cardiac myocyte contractility. May regulate myocardial angiogenesis implicating KDR. Overexpression mediates cardioprotection and angiogenesis after induced damage. Stabilizes monomeric YWHAZ thereby supporting YWHAZ chaperone-like activity.", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6#function" }, { "database": "UniProtKB", "id": "O14558", "url": "https://www.uniprot.org/uniprot/O14558#function" } ] }, { "annotation": "The Cardioprotective PKA-Mediated Hsp20 Phosphorylation Modulates Protein Associations Regulating Cytoskeletal Dynamics. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001012401", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401" }, { "database": "PubMed", "id": "33339131", "url": "https://glygen.org/publication/PubMed/33339131" } ] }, { "annotation": "These findings suggest a role of Hsp20 in mediating adipocyte function by linking beta-adrenergic signaling to PPARgamma activity.", "evidence": [ { "database": "RefSeq", "id": "NP_001012401", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401" }, { "database": "PubMed", "id": "29925002", "url": "https://glygen.org/publication/PubMed/29925002" } ] } ], "disease": [ { "disease_id": "DOID:0080093", "recommended_name": { "id": "DOID:0080093", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080093", "name": "myofibrillar myopathy 2", "description": "A myofibrillar myopathy that has_material_basis_in heterozygous mutation in the alpha-B-crystallin gene on chromosome 11q23." }, "synonyms": [ { "id": "DOID:0080093", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080093", "name": "alpha-b crystallinopathy", "description": "" }, { "id": "MONDO:0012130", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012130", "name": "myofibrillar myopathy 2", "description": "Any autosomal dominant distal myopathy in which the cause of the disease is a mutation in the CRYAB gene." }, { "id": "MONDO:0012130", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012130", "name": "CRYAB autosomal dominant distal myopathy", "description": "" }, { "id": "MONDO:0012130", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012130", "name": "alpha-B crystallinopathy", "description": "" }, { "id": "MONDO:0012130", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012130", "name": "autosomal dominant distal myopathy caused by mutation in CRYAB", "description": "" }, { "id": "MONDO:0012130", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012130", "name": "late-onset distal crystallinopathy", "description": "" }, { "id": "MONDO:0012130", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012130", "name": "myofibrillar myopathy type 2", "description": "" }, { "id": "MONDO:0012130", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012130", "name": "myopathy, myofibrillar, type 2", "description": "" }, { "id": "MONDO:0012130", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012130", "name": "MFM2", "description": "" }, { "id": "MONDO:0012130", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012130", "name": "alpha-B crystallin-related late-onset distal myopathy", "description": "" }, { "id": "MONDO:0012130", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012130", "name": "myopathy, desmin-related, associated with mutation in the Cryab Gene", "description": "" }, { "id": "MONDO:0012130", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012130", "name": "myopathy, myofibrillar, 2", "description": "" }, { "id": "MONDO:0012130", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012130", "name": "myopathy, myofibrillar, alpha-B crystallin-related", "description": "" }, { "id": "MONDO:0012130", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012130", "name": "myopathy, myofibrillar, with or without cataract and/or cardiomyopathy", "description": "" }, { "id": "MIM:608810", "resource": "MIM", "url": "https://www.omim.org/entry/608810", "name": "Myopathy, myofibrillar, 2", "description": "Myopathy, myofibrillar, 2" } ], "evidence": [ { "id": "0080093", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080093" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Hspb6", "url": "https://www.uniprot.org/uniprot/Q5EBG6", "locus": { "chromosome": "7", "start_pos": 30254868, "end_pos": 30251603, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000036854", "url": "https://www.ensembl.org/id/ENSMUSG00000036854" } ] } } ], "crossref": [ { "id": "ENSMUSG00000036854", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000036854", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd06478", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06478", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "243912", "url": "https://www.ncbi.nlm.nih.gov/gene/243912", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q5EBG6", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q5EBG6*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001436", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001436", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002068", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002068", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003090", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003090", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008978", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008978", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:243912", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:243912", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2685325", "url": "http://www.informatics.jax.org/marker/MGI:2685325", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q5EBG6", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q5EBG6", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PVQPTWL", "url": "https://omabrowser.org/oma/group/PVQPTWL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3014506at2759", "url": "http://www.orthodb.org/?query=3014506at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45640", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45640", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45640:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45640:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00011", "url": "http://pfam.xfam.org/family/PF00011", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00525", "url": "http://pfam.xfam.org/family/PF00525", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q5EBG6", "url": "http://purl.obolibrary.org/obo/PR_Q5EBG6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001012401", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5EBG6-1", "url": "https://www.uniprot.org/uniprot/Q5EBG6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEIPVPVQPSWLRRASAPLPGFSAPGRLFDQRFGEGLLEAELASLCPAAIAPYYLRAPSVALPTAQVSTDSGYFSVLLDVKHFLPEEISVKVVDDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQATPASAQAQLPSPPAAK", "length": 162, "header": "sp|Q5EBG6-1|HSPB6_MOUSE Isoform 1 of Heat shock protein beta-6 OS=Mus musculus OX=10090 GN=Hspb6 PE=1 SV=1 CANONICAL=Q5EBG6-1" }, "isoforms": [ { "isoform_ac": "Q5EBG6-1", "url": "", "sequence": { "sequence": "MEIPVPVQPSWLRRASAPLPGFSAPGRLFDQRFGEGLLEAELASLCPAAIAPYYLRAPSVALPTAQVSTDSGYFSVLLDVKHFLPEEISVKVVDDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQATPASAQAQLPSPPAAK", "length": 162, "header": "sp|Q5EBG6-1|HSPB6_MOUSE Isoform 1 of Heat shock protein beta-6 OS=Mus musculus OX=10090 GN=Hspb6 PE=1 SV=1 CANONICAL=Q5EBG6-1" }, "locus": { "chromosome": "7", "start_pos": 30254058, "end_pos": 30252760, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000044048", "url": "https://www.ensembl.org/id/ENSMUST00000044048" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000039172", "url": "https://www.ensembl.org/id/ENSMUSP00000039172" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q5EBG6", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q5EBG6" }, { "id": "36288343", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36288343" } ] } ], "phosphorylation": [ { "start_pos": 157, "end_pos": 157, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "site_lbl": "Ser157" }, { "start_pos": 16, "end_pos": 16, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" }, { "database": "PubMed", "id": "21334344", "url": "https://glygen.org/publication/PubMed/21334344" }, { "database": "iPTMnet", "id": "Q5EBG6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5EBG6" }, { "database": "PubMed", "id": "20854253", "url": "https://glygen.org/publication/PubMed/20854253" }, { "database": "PubMed", "id": "22260692", "url": "https://glygen.org/publication/PubMed/22260692" }, { "database": "PubMed", "id": "23713735", "url": "https://glygen.org/publication/PubMed/23713735" } ], "site_lbl": "Ser16" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Phosphoproteome analysis of cardiomyocytes subjected to beta-adrenergic stimulation: identification and characterization of a cardiac heat shock protein p20.", "journal": "Circulation research", "date": "2004", "authors": "Chu G, Egnaczyk GF, Zhao W, Jo SH, Fan GC, Maggio JE, Xiao RP, Kranias EG", "evidence": [ { "database": "RefSeq", "id": "NP_001012401", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401" } ], "reference": [ { "type": "PubMed", "id": "14615292", "url": "https://glygen.org/publication/PubMed/14615292" } ] }, { "title": "Small heat-shock protein Hsp20 phosphorylation inhibits beta-agonist-induced cardiac apoptosis.", "journal": "Circulation research", "date": "2004", "authors": "Fan GC, Chu G, Mitton B, Song Q, Yuan Q, Kranias EG", "evidence": [ { "database": "RefSeq", "id": "NP_001012401", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401" } ], "reference": [ { "type": "PubMed", "id": "15105294", "url": "https://glygen.org/publication/PubMed/15105294" } ] }, { "title": "Hsp20 protects neuroblastoma cells from ischemia/reperfusion injury by inhibition of apoptosis via a mechanism that involves the mitochondrial pathways.", "journal": "Current neurovascular research", "date": "2010", "authors": "Zeng L, Tan J, Hu Z, Lu W, Yang B", "evidence": [ { "database": "iPTMnet", "id": "Q5EBG6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5EBG6" } ], "reference": [ { "type": "PubMed", "id": "20854253", "url": "https://glygen.org/publication/PubMed/20854253" } ] }, { "title": "Disruption of the cyclic AMP phosphodiesterase-4 (PDE4)-HSP20 complex attenuates the beta-agonist induced hypertrophic response in cardiac myocytes.", "journal": "Journal of molecular and cellular cardiology", "date": "2011", "authors": "Sin YY, Edwards HV, Li X, Day JP, Christian F, Dunlop AJ, Adams DR, Zaccolo M, Houslay MD, Baillie GS", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" }, { "database": "iPTMnet", "id": "Q5EBG6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5EBG6" } ], "reference": [ { "type": "PubMed", "id": "21334344", "url": "https://glygen.org/publication/PubMed/21334344" } ] }, { "title": "PKA phosphorylation of the small heat-shock protein Hsp20 enhances its cardioprotective effects.", "journal": "Biochemical Society transactions", "date": "2012", "authors": "Edwards HV, Scott JD, Baillie GS", "evidence": [ { "database": "iPTMnet", "id": "Q5EBG6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5EBG6" } ], "reference": [ { "type": "PubMed", "id": "22260692", "url": "https://glygen.org/publication/PubMed/22260692" } ] }, { "title": "Blockade of Ser16-Hsp20 phosphorylation attenuates neuroprotection dependent upon Bcl-2 and Bax.", "journal": "Current neurovascular research", "date": "2013", "authors": "Zeng L, Tan J, Lu W, Hu Z", "evidence": [ { "database": "iPTMnet", "id": "Q5EBG6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5EBG6" } ], "reference": [ { "type": "PubMed", "id": "23713735", "url": "https://glygen.org/publication/PubMed/23713735" } ] }, { "title": "An Hsp20-FBXO4 Axis Regulates Adipocyte Function through Modulating PPARgamma Ubiquitination.", "journal": "Cell reports", "date": "2018", "authors": "Peng J, Li Y, Wang X, Deng S, Holland J, Yates E, Chen J, Gu H, Essandoh K, Mu X, Wang B, McNamara RK, Peng T, Jegga AG, Liu T, Nakamura T, Huang K, Perez-Tilve D, Fan GC", "evidence": [ { "database": "RefSeq", "id": "NP_001012401", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401" } ], "reference": [ { "type": "PubMed", "id": "29925002", "url": "https://glygen.org/publication/PubMed/29925002" } ] }, { "title": "Small Heat Shock Proteins B1 and B6: Which One is the Most Effective Adjuvant in Therapeutic HPV Vaccine?", "journal": "IUBMB life", "date": "2018", "authors": "Bolhassani A, Shahbazi S, Milani A, Nadji SA", "evidence": [ { "database": "RefSeq", "id": "NP_001012401", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401" } ], "reference": [ { "type": "PubMed", "id": "30171788", "url": "https://glygen.org/publication/PubMed/30171788" } ] }, { "title": "HSP20-mediated cardiomyocyte exosomes improve cardiac function in mice with myocardial infarction by activating Akt signaling pathway.", "journal": "European review for medical and pharmacological sciences", "date": "2019", "authors": "Yu DW, Ge PP, Liu AL, Yu XY, Liu TT", "evidence": [ { "database": "RefSeq", "id": "NP_001012401", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401" } ], "reference": [ { "type": "PubMed", "id": "31210321", "url": "https://glygen.org/publication/PubMed/31210321" } ] }, { "title": "Probenecid treatment improves outcomes in a novel mouse model of peripartum cardiomyopathy.", "journal": "PloS one", "date": "2020", "authors": "Onusko E, McDermott MR, Robbins N, Liu G, Kranias EG, Rubinstein J, Koch SE", "evidence": [ { "database": "RefSeq", "id": "NP_001012401", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401" } ], "reference": [ { "type": "PubMed", "id": "32218573", "url": "https://glygen.org/publication/PubMed/32218573" } ] }, { "title": "The Cardioprotective PKA-Mediated Hsp20 Phosphorylation Modulates Protein Associations Regulating Cytoskeletal Dynamics.", "journal": "International journal of molecular sciences", "date": "2020", "authors": "Vafiadaki E, Arvanitis DA, Eliopoulos AG, Kranias EG, Sanoudou D", "evidence": [ { "database": "RefSeq", "id": "NP_001012401", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012401" } ], "reference": [ { "type": "PubMed", "id": "33339131", "url": "https://glygen.org/publication/PubMed/33339131" } ] }, { "title": "First comprehensive identification of cardiac proteins with putative increased O-GlcNAc levels during pressure overload hypertrophy.", "journal": "PloS one", "date": "2022", "authors": "Zhu Wei Zhong, Palazzo Teresa, Zhou Mowei, Ledee Dolena, Olson Heather M, Pa\u0161a-Toli\u0107 Ljiljana, Olson Aaron K", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q5EBG6", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q5EBG6" } ], "reference": [ { "type": "PubMed", "id": "36288343", "url": "https://glygen.org/publication/PubMed/36288343" } ] } ], "pathway": [ { "id": "mmu:243912", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:243912", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O14558-1", "protein_name": "Heat shock protein beta-6", "gene_name": "HSPB6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK", "length": 160 }, "evidence": [ { "id": "45229582", "url": "http://www.informatics.jax.org/homology/45229582", "database": "MGI" }, { "id": "Q5EBG6", "url": "https://omabrowser.org/oma/group/Q5EBG6/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P82147-1", "protein_name": "Protein lethal(2)essential for life", "gene_name": "l(2)efl", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSVVPLMFRDWWDELDFPMRTSRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTNSLQKQESGSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLVQITQTGPSSKEDNAKKVETSTA", "length": 187 }, "evidence": [ { "id": "Q5EBG6", "url": "https://omabrowser.org/oma/group/Q5EBG6/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "P97541-1", "protein_name": "Heat shock protein beta-6", "gene_name": "Hspb6", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEIRVPVQPSWLRRASAPLPGFSTPGRLFDQRFGEGLLEAELASLCPAAIAPYYLRAPSVALPTAQVPTDPGYFSVLLDVKHFSPEEISVKVVGDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQATPASAQASLPSPPAAK", "length": 162 }, "evidence": [ { "id": "45229582", "url": "http://www.informatics.jax.org/homology/45229582", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "pmid": "" }, { "name": "nuclear speck", "id": "GO:0016607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016607", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "pmid": "" }, { "name": "unfolded protein binding", "id": "GO:0051082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051082", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "pmid": "" }, { "name": "protein-folding chaperone binding", "id": "GO:0051087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051087", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "pmid": "" }, { "name": "structural constituent of eye lens", "id": "GO:0005212", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005212", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "pmid": "" }, { "name": "protein folding chaperone", "id": "GO:0044183", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044183", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "pmid": "" }, { "name": "positive regulation of angiogenesis", "id": "GO:0045766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045766", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "pmid": "" }, { "name": "response to heat", "id": "GO:0009408", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009408", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "pmid": "" }, { "name": "negative regulation of cardiac muscle cell apoptotic process", "id": "GO:0010667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010667", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "pmid": "" }, { "name": "protein refolding", "id": "GO:0042026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042026", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "pmid": "" }, { "name": "chaperone-mediated protein folding", "id": "GO:0061077", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061077", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Phosphorylated at Ser-16 by PKA and probably PKD1K; required to protect cardiomyocytes from apoptosis.", "evidence": [ { "database": "UniProtKB", "id": "Q5EBG6", "url": "https://www.uniprot.org/uniprot/Q5EBG6" }, { "database": "PubMed", "id": "O14558", "url": "https://glygen.org/publication/PubMed/O14558" }, { "database": "PubMed", "id": "P97541", "url": "https://glygen.org/publication/PubMed/P97541" }, { "database": "PubMed", "id": "21334344", "url": "https://glygen.org/publication/PubMed/21334344" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }