{ "uniprot_canonical_ac": "Q5D006-1", "uniprot_ac": "Q5D006", "uniprot_id": "UBP11_RAT", "mass": { "chemical_mass": 105239.0, "monoisotopic_mass": 105239.0 }, "refseq": { "ac": "NP_001008861", "name": "ubiquitin carboxyl-terminal hydrolase 11", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008861" }, "gene_names": [ { "name": "Usp11", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5D006", "id": "Q5D006" }, { "name": "Uhx1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008861", "id": "NP_001008861" }, { "name": "Usp11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008861", "id": "NP_001008861" } ], "protein_names": [ { "name": "Ubiquitin carboxyl-terminal hydrolase 11", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q5D006" }, { "name": "3.4.19.12", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5D006" }, { "name": "Deubiquitinating enzyme 11", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5D006" }, { "name": "Ubiquitin thioesterase 11", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5D006" }, { "name": "Ubiquitin-specific-processing protease 11", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5D006" }, { "name": "ubiquitin carboxyl-terminal hydrolase 11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008861", "id": "NP_001008861" }, { "name": "ubiquitin specific protease 11; ubiquitin thioesterase 11; deubiquitinating enzyme 11; ubiquitin-specific-processing protease 11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008861", "id": "NP_001008861" } ], "function": [ { "annotation": "Deubiquitinating enzyme that removes conjugated ubiquitin from specific proteins to regulate different cellular processes.", "evidence": [ { "database": "UniProtKB", "id": "A0A8L2QN44", "url": "https://www.uniprot.org/uniprot/A0A8L2QN44#function" }, { "database": "UniProtKB", "id": "RU366025", "url": "https://www.uniprot.org/uniprot/RU366025#function" } ] }, { "annotation": "Protease that can remove conjugated ubiquitin from target proteins and polyubiquitin chains. Inhibits the degradation of target proteins by the proteasome. Cleaves preferentially 'Lys-6' and 'Lys-63'-linked ubiquitin chains. Has lower activity with 'Lys-11' and 'Lys-33'-linked ubiquitin chains, and extremely low activity with 'Lys-27', 'Lys-29' and 'Lys-48'-linked ubiquitin chains (in vitro). Plays a role in the regulation of pathways leading to NF-kappa-B activation. Plays a role in the regulation of DNA repair after double-stranded DNA breaks. Acts as a chromatin regulator via its association with the Polycomb group (PcG) multiprotein PRC1-like complex; may act by deubiquitinating components of the PRC1-like comple. Promotes cell proliferation by deubiquitinating phosphorylated E2F1x.", "evidence": [ { "database": "UniProtKB", "id": "Q5D006", "url": "https://www.uniprot.org/uniprot/Q5D006#function" }, { "database": "UniProtKB", "id": "P51784", "url": "https://www.uniprot.org/uniprot/P51784#function" } ] }, { "annotation": "USP11 exacerbates neuronal apoptosis after traumatic brain injury via PKM2-mediated PI3K/AKT signaling pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_001008861", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008861" }, { "database": "PubMed", "id": "36898475", "url": "https://glygen.org/publication/PubMed/36898475" } ] }, { "annotation": "USP11 is upregulated in neurons adjacent to the hematoma following ICH.", "evidence": [ { "database": "RefSeq", "id": "NP_001008861", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008861" }, { "database": "PubMed", "id": "26334325", "url": "https://glygen.org/publication/PubMed/26334325" } ] }, { "annotation": "Ubiquitin-specific protease 11 Aggravates Ischemia-reperfusion-induced Cardiomyocyte Pyroptosis and Injury by Promoting TRAF3 Deubiquitination.", "evidence": [ { "database": "RefSeq", "id": "NP_001008861", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008861" }, { "database": "PubMed", "id": "37000116", "url": "https://glygen.org/publication/PubMed/37000116" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q5D006", "url": "https://www.uniprot.org/uniprot/Q5D006" } ], "common_name": "Rat" } ], "gene": [ { "name": "Usp11", "url": "https://www.uniprot.org/uniprot/Q5D006", "locus": { "chromosome": "X", "start_pos": 1473350, "end_pos": 1489520, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000009049", "url": "https://www.ensembl.org/id/ENSRNOG00000009049" } ] } } ], "crossref": [ { "id": "ENSRNOG00000009049", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000009049", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd02674", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02674", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "408217", "url": "https://www.ncbi.nlm.nih.gov/gene/408217", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001394", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001394", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006615", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006615", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018200", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018200", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028135", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028135", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028889", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028889", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035927", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035927", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038765", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038765", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:408217", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:408217", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "TGQLVIM", "url": "https://omabrowser.org/oma/group/TGQLVIM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5474185at2759", "url": "http://www.orthodb.org/?query=5474185at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21646", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21646", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21646:SF29", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21646:SF29", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "4MEM", "url": "https://www.rcsb.org/structure/4MEM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00443", "url": "http://pfam.xfam.org/family/PF00443", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF06337", "url": "http://pfam.xfam.org/family/PF06337", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF14836", "url": "http://pfam.xfam.org/family/PF14836", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q5D006", "url": "http://purl.obolibrary.org/obo/PR_Q5D006", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5689880", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001008861", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008861", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1303052", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1303052", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8L2QN44", "url": "https://www.uniprot.org/uniprot/A0A8L2QN44", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2QN44-1", "url": "https://www.uniprot.org/uniprot/A0A8L2QN44-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5D006", "url": "https://www.uniprot.org/uniprot/Q5D006", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5D006-1", "url": "https://www.uniprot.org/uniprot/Q5D006-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAVAADPAAAAVPASAEDRETQPEAMPDLDQQWRQIGNGRERPLRAGESWFLVEKHWYKQWEAYVKGGDQDASTFPGSINNSGLFEDQISWHLRERLVEGDDYVLLPAPAWNYLVSWYGLKDDQPPIERKVIELPGIRKVEVYPIELLLVQHSDMETALTIQFSYSDSVDLVLQTAREQFLVEPQEDTRLWTKNSEGSLDRLCNTQITLLDACLETGQLVIMETRNKDGTWPSAQLCGMNNMPDEDEDFQGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNRYLEELNFRNPLGMKGELAEAYADLVKQTWSGYHRSIVPNVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYVELCNGAGRPDLEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPVCSRRVLEVFFVPMDPRRKPEQHRVVVPKKGNISDLCVALSTHTSVAPDKMIVADVFSHRFYKLYQLEDPLSGILDRDDIFVYEVTGRIEPVEGSRDDIVVPVYLRERTPSRDYNNSYYGLILFGHPLLVSVPRDRFSWEGLYNILMYRLSRYVTKPTSDDDDGDEKGDENEDEDVEDDSSSEEEKEEMSGPTDNDGTQESEQEQAGTSSGVTGRCPSLLDNSLHTSQWPPRRRRKQLFTLQTVNSNGTSDRTTSPEEAQTQPYIAMDWEPEMKRRYYDEVEAEGYVKHDCVGYMLKKNPVQLKECIKLFTTVETLEKENPWYCSSCKQHQLATKKLDLWMLPEVLIIHLKRFSFSKFSREKLDTLVQFPIRDLDFSEFVIKPKNESAPDLYKYDLIAVSNHYGGMRDGHYTTFACNKDSGQWHYFDDNSVSPVNENQIESKAAYVLFYQRQDVGRRQSQTASSETPTSPASSSTPNSDIMDVN", "length": 921, "header": "sp|Q5D006-1|UBP11_RAT Isoform 1 of Ubiquitin carboxyl-terminal hydrolase 11 OS=Rattus norvegicus OX=10116 GN=Usp11 PE=1 SV=1 CANONICAL=Q5D006-1" }, "isoforms": [ { "isoform_ac": "A0A8L2QN44-1", "url": "", "sequence": { "sequence": "METRNKDGTWPSAQLCGMNNMPDEDEDFQGQPGICGLTNLGNTCFMNSALQQCLSNVPQLTEYFLNNRYLEELNFRNPLGMKGELAEAYADLVKQTWSGYHRSIVPNVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYVELCNGAGRPDLEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPVCSRRVLEVFFVPMDPRRKPEQHRVVVPKKGNISDLCVALSTHTSVAPDKMIVADVFSHRFYKLYQLEDPLSGILDRDDIFVYEVTGRIEPVEGSRDDIVVPVYLRERTPSRDYNNSYYGLILFGHPLLVSVPRDRFSWEGLYNILMYRLSRYVTKPTSDDDDGDEKGDENEDEDVEDDSSSEEEKEEMSGPTDNDGTQESEQEQAGTSSGVTGRCPSLLDNSLHTSQWPPRRRRKQLFTLQTVNSNGTSDRTTSPEEAQTQPYIAMDWEPEMKRRYYDEVEAEGYVKHDCVGYMLKKNPVQLKECIKLFTTVETLEKENPWYCSSCKQHQLATKKLDLWMLPEVLIIHLKRFSFSKFSREKLDTLVQFPIRDLDFSEFVIKPKNESAPDLYKYDLIAVSNHYGGMRDGHYTTFACNKDSGQWHYFDDNSVSPVNENQIESKAAYVLFYQRQDVGRRQSQTASSETPTSPASSSTPNSDIMDVN", "length": 700, "header": "tr|A0A8L2QN44-1|UBP11_RAT Computationally mapped isoform of Ubiquitin carboxyl-terminal hydrolase 11 OS=Rattus norvegicus OX=10116 GN=Usp11 PE=1 SV=1 CANONICAL=Q5D006-1" }, "locus": { "chromosome": "X", "start_pos": 1480413, "end_pos": 1473976, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000051956.6", "url": "https://www.ensembl.org/id/ENSRNOT00000051956.6" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000042897.6", "url": "https://www.ensembl.org/id/ENSRNOP00000042897.6" } ] } }, { "isoform_ac": "Q5D006-1", "url": "", "sequence": { "sequence": "MAAVAADPAAAAVPASAEDRETQPEAMPDLDQQWRQIGNGRERPLRAGESWFLVEKHWYKQWEAYVKGGDQDASTFPGSINNSGLFEDQISWHLRERLVEGDDYVLLPAPAWNYLVSWYGLKDDQPPIERKVIELPGIRKVEVYPIELLLVQHSDMETALTIQFSYSDSVDLVLQTAREQFLVEPQEDTRLWTKNSEGSLDRLCNTQITLLDACLETGQLVIMETRNKDGTWPSAQLCGMNNMPDEDEDFQGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNRYLEELNFRNPLGMKGELAEAYADLVKQTWSGYHRSIVPNVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYVELCNGAGRPDLEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPVCSRRVLEVFFVPMDPRRKPEQHRVVVPKKGNISDLCVALSTHTSVAPDKMIVADVFSHRFYKLYQLEDPLSGILDRDDIFVYEVTGRIEPVEGSRDDIVVPVYLRERTPSRDYNNSYYGLILFGHPLLVSVPRDRFSWEGLYNILMYRLSRYVTKPTSDDDDGDEKGDENEDEDVEDDSSSEEEKEEMSGPTDNDGTQESEQEQAGTSSGVTGRCPSLLDNSLHTSQWPPRRRRKQLFTLQTVNSNGTSDRTTSPEEAQTQPYIAMDWEPEMKRRYYDEVEAEGYVKHDCVGYMLKKNPVQLKECIKLFTTVETLEKENPWYCSSCKQHQLATKKLDLWMLPEVLIIHLKRFSFSKFSREKLDTLVQFPIRDLDFSEFVIKPKNESAPDLYKYDLIAVSNHYGGMRDGHYTTFACNKDSGQWHYFDDNSVSPVNENQIESKAAYVLFYQRQDVGRRQSQTASSETPTSPASSSTPNSDIMDVN", "length": 921, "header": "sp|Q5D006-1|UBP11_RAT Isoform 1 of Ubiquitin carboxyl-terminal hydrolase 11 OS=Rattus norvegicus OX=10116 GN=Usp11 PE=1 SV=1 CANONICAL=Q5D006-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 596, "end_pos": 596, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q5D006", "url": "https://www.uniprot.org/uniprot/Q5D006" } ], "site_lbl": "Ser596" }, { "start_pos": 692, "end_pos": 692, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q5D006", "url": "https://www.uniprot.org/uniprot/Q5D006" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "iPTMnet", "id": "Q5D006", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5D006" } ], "site_lbl": "Ser692" }, { "start_pos": 906, "end_pos": 906, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q5D006", "url": "https://www.uniprot.org/uniprot/Q5D006" } ], "site_lbl": "Ser906" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nature communications", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "Q5D006", "url": "https://www.uniprot.org/uniprot/Q5D006" }, { "database": "iPTMnet", "id": "Q5D006", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5D006" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] }, { "title": "Structure and catalytic regulatory function of ubiquitin specific protease 11 N-terminal and ubiquitin-like domains.", "journal": "Biochemistry", "date": "2014", "authors": "Scott D.J., Emsley J., Oberer M., Harper S., Dreveny I., Cornaciu I., Gratton H.E.", "evidence": [ { "database": "UniProtKB", "id": "Q5D006", "url": "https://www.uniprot.org/uniprot/Q5D006" } ], "reference": [ { "type": "PubMed", "id": "24724799", "url": "https://glygen.org/publication/PubMed/24724799" } ] }, { "title": "USP11, Deubiquitinating Enzyme, Associated with Neuronal Apoptosis Following Intracerebral Hemorrhage.", "journal": "Journal of molecular neuroscience : MN", "date": "2016", "authors": "Xu Z, Li X, Chen J, Zhao J, Wang J, Ji Y, Shen Y, Han L, Shi J, Zhang D", "evidence": [ { "database": "RefSeq", "id": "NP_001008861", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008861" } ], "reference": [ { "type": "PubMed", "id": "26334325", "url": "https://glygen.org/publication/PubMed/26334325" } ] }, { "title": "USP11 exacerbates neuronal apoptosis after traumatic brain injury via PKM2-mediated PI3K/AKT signaling pathway.", "journal": "Brain research", "date": "2023-05-15", "authors": "Fang Yiling, Zhao Tianheng, Ni Haibo, Li Yajun, Zhu Yongkui, Gao Rong, Zhang Li, Jia Zhenyu, Chen Gang", "evidence": [ { "database": "RefSeq", "id": "NP_001008861", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008861" } ], "reference": [ { "type": "PubMed", "id": "36898475", "url": "https://glygen.org/publication/PubMed/36898475" } ] }, { "title": "Ubiquitin-specific protease 11 Aggravates Ischemia-reperfusion-induced Cardiomyocyte Pyroptosis and Injury by Promoting TRAF3 Deubiquitination.", "journal": "Balkan medical journal", "date": "2023", "authors": "Zhang Y, Hailati J, Ma X, Midilibieke H, Liu Z", "evidence": [ { "database": "RefSeq", "id": "NP_001008861", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001008861" } ], "reference": [ { "type": "PubMed", "id": "37000116", "url": "https://glygen.org/publication/PubMed/37000116" } ] } ], "pathway": [ { "id": "rno:408217", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:408217", "resource": "KEGG Pathway" }, { "id": "R-RNO-5689880", "name": "Ub-specific processing proteases", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5689880", "resource": "Reactome", "description": "Ub-specific processing proteases" } ], "orthologs": [ { "uniprot_canonical_ac": "Q99K46-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 11", "gene_name": "Usp11", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAAVAADPAAAAVPASAEDRDTQPEAMPDLDEQWRQIGNGRERPLRAGESWFLVEKHWYKQWEVYVKGGDQDASTFPGCINNAGLFEDQISWHLRERLLEGDDYVLLPAPAWNYMVSWYGLMDGQPPIERKVIELPGIRKVEVYPLELLLVQHSDMETALTIQFSYTDSVELVLQTAREQFLVEPQEDTRLWTKNSEGSLDRLCNTQITLLDACLETGQLVIMETRNKDGTWPSAQLCGMNNIPDEDEDFQGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNRYLEELNFRNPLGMKGELAEAYADLVKQTWSGYHRSIVPNVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYVELCNGAGRPDLEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPVCSRRVLEVFFVPMDPRRKPEQHRVVVPKKGNISDLCVALSTHTSVAPDKMIVADVFSHRFYKLYQLEDPLSGILDRDDIFVYEVTGRIEPVEGSRDDIVVPVYLRERTPSRDYNNSYYGLILFGHPLLVSVPRDRFSWEGLYNILMYRLSRYVTKPTSDEDDGDEKVDEDEDEDVEDDSSSEEEKEEMSAPTVNDGTREAEQEQAGTSSGVTERCPSLLDNSLRASQWPPRRRRKQLFTLQTVNSNGTSDRTTSPEEMQTQPYIAMDWEPDMKRRYYDEVEAEGYVKHDCVGYMLKKSPVQLKECIKLFTTVETLEKENPWYCSSCKQHQLATKKLDLWMLPEVLIIHLKRFSFSKISREKLDTLVQFPIRDLDFSEFVIKPKNESSPDLYKYDLIAVSNHYGGMRDGHYTTFACNKDSGQWHYFDDNSVSPVNENQIESKAAYVLFYQRQDVGRRQSQTSSSDTPASPVSSSTPNSDIMDIN", "length": 921 }, "evidence": [ { "id": "45231515", "url": "http://www.informatics.jax.org/homology/45231515", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q5D006", "url": "https://www.uniprot.org/uniprot/Q5D006" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q5D006", "url": "https://www.uniprot.org/uniprot/Q5D006" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q5D006", "url": "https://www.uniprot.org/uniprot/Q5D006" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q5D006", "url": "https://www.uniprot.org/uniprot/Q5D006" } ], "pmid": "" }, { "name": "chromosome", "id": "GO:0005694", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005694", "evidence": [ { "database": "UniProtKB", "id": "Q5D006", "url": "https://www.uniprot.org/uniprot/Q5D006" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "protein deubiquitination", "id": "GO:0016579", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016579", "evidence": [ { "database": "UniProtKB", "id": "Q5D006", "url": "https://www.uniprot.org/uniprot/Q5D006" } ], "pmid": "" }, { "name": "ubiquitin-dependent protein catabolic process", "id": "GO:0006511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006511", "evidence": [ { "database": "UniProtKB", "id": "Q5D006", "url": "https://www.uniprot.org/uniprot/Q5D006" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "cysteine-type deubiquitinase activity", "id": "GO:0004843", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004843", "evidence": [ { "database": "UniProtKB", "id": "Q5D006", "url": "https://www.uniprot.org/uniprot/Q5D006" } ], "pmid": "" }, { "name": "cysteine-type endopeptidase activity", "id": "GO:0004197", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004197", "evidence": [ { "database": "UniProtKB", "id": "Q5D006", "url": "https://www.uniprot.org/uniprot/Q5D006" } ], "pmid": "" }, { "name": "transcription corepressor binding", "id": "GO:0001222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001222", "evidence": [ { "database": "UniProtKB", "id": "Q5D006", "url": "https://www.uniprot.org/uniprot/Q5D006" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 398, "end_pos": 400, "annotation": "n_glycosylation_sequon" }, { "start_pos": 421, "end_pos": 423, "annotation": "n_glycosylation_sequon" }, { "start_pos": 469, "end_pos": 471, "annotation": "n_glycosylation_sequon" }, { "start_pos": 552, "end_pos": 554, "annotation": "n_glycosylation_sequon" }, { "start_pos": 684, "end_pos": 686, "annotation": "n_glycosylation_sequon" }, { "start_pos": 81, "end_pos": 83, "annotation": "n_glycosylation_sequon" }, { "start_pos": 822, "end_pos": 824, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-RNO-6781897", "name": "USP11 deubiquitinates NFKBIA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5D006-1" ], "evidence": [ { "id": "R-RNO-6781897", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6781897" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "Q5D006", "gene_name": "Usp11", "activity": [ { "ec_number": "3.4.19.12", "activity": "Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).", "evidence": [ { "id": "Q5D006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5D006" } ] }, { "ec_number": "3.4.19.12", "activity": "", "evidence": [ { "id": "Q5D006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5D006" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }