{ "uniprot_canonical_ac": "Q5BJM7-1", "uniprot_ac": "Q5BJM7", "uniprot_id": "C42S1_RAT", "mass": { "chemical_mass": 8967.0, "monoisotopic_mass": 8967.0 }, "refseq": { "ac": "NP_001034133", "name": "CDC42 small effector protein 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034133" }, "gene_names": [ { "name": "Cdc42se1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5BJM7", "id": "Q5BJM7" }, { "name": "Cdc42se1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034133", "id": "NP_001034133" } ], "protein_names": [ { "name": "CDC42 small effector protein 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q5BJM7" }, { "name": "CDC42 small effector protein 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034133", "id": "NP_001034133" } ], "function": [ { "annotation": "Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q5BJM7", "url": "https://www.uniprot.org/uniprot/Q5BJM7#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q5BJM7", "url": "https://www.uniprot.org/uniprot/Q5BJM7" } ], "common_name": "Rat" } ], "gene": [ { "name": "Cdc42se1", "url": "https://www.uniprot.org/uniprot/Q5BJM7", "locus": {} } ], "crossref": [ { "id": "ENSRNOG00000060538", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000060538", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "499672", "url": "https://www.ncbi.nlm.nih.gov/gene/499672", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000095", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000095", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036936", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036936", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039056", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039056", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:499672", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:499672", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2787572at2759", "url": "http://www.orthodb.org/?query=2787572at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13502", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13502", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13502:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13502:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PR_Q5BJM7", "url": "http://purl.obolibrary.org/obo/PR_Q5BJM7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001034133", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034133", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1561700", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1561700", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "Q5BJM7", "url": "https://www.uniprot.org/uniprot/Q5BJM7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5BJM7-1", "url": "https://www.uniprot.org/uniprot/Q5BJM7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSEFWHKLGCCVVEKPQPKKRRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRAL", "length": 79, "header": "sp|Q5BJM7-1|C42S1_RAT Isoform 1 of CDC42 small effector protein 1 OS=Rattus norvegicus OX=10116 GN=Cdc42se1 PE=3 SV=1 CANONICAL=Q5BJM7-1" }, "isoforms": [ { "isoform_ac": "Q5BJM7-1", "url": "", "sequence": { "sequence": "MSEFWHKLGCCVVEKPQPKKRRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRAL", "length": 79, "header": "sp|Q5BJM7-1|C42S1_RAT Isoform 1 of CDC42 small effector protein 1 OS=Rattus norvegicus OX=10116 GN=Cdc42se1 PE=3 SV=1 CANONICAL=Q5BJM7-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "rno:499672", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:499672", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8BHL7-1", "protein_name": "CDC42 small effector protein 1", "gene_name": "Cdc42se1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNHRDRPWSNSRAL", "length": 80 }, "evidence": [ { "id": "45225535", "url": "http://www.informatics.jax.org/homology/45225535", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9NRR8-1", "protein_name": "CDC42 small effector protein 1", "gene_name": "CDC42SE1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL", "length": 79 }, "evidence": [ { "id": "45225535", "url": "http://www.informatics.jax.org/homology/45225535", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q5BJM7", "url": "https://www.uniprot.org/uniprot/Q5BJM7" } ], "pmid": "" }, { "name": "cytoskeleton", "id": "GO:0005856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005856", "evidence": [ { "database": "UniProtKB", "id": "Q5BJM7", "url": "https://www.uniprot.org/uniprot/Q5BJM7" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q5BJM7", "url": "https://www.uniprot.org/uniprot/Q5BJM7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "phagocytosis", "id": "GO:0006909", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006909", "evidence": [ { "database": "UniProtKB", "id": "Q5BJM7", "url": "https://www.uniprot.org/uniprot/Q5BJM7" } ], "pmid": "" }, { "name": "regulation of Rho protein signal transduction", "id": "GO:0035023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035023", "evidence": [ { "database": "UniProtKB", "id": "Q5BJM7", "url": "https://www.uniprot.org/uniprot/Q5BJM7" } ], "pmid": "" }, { "name": "regulation of cell shape", "id": "GO:0008360", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008360", "evidence": [ { "database": "UniProtKB", "id": "Q5BJM7", "url": "https://www.uniprot.org/uniprot/Q5BJM7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "small GTPase binding", "id": "GO:0031267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031267", "evidence": [ { "database": "UniProtKB", "id": "Q5BJM7", "url": "https://www.uniprot.org/uniprot/Q5BJM7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }