{ "uniprot_canonical_ac": "Q5BJ95-1", "uniprot_ac": "Q5BJ95", "uniprot_id": "IL17F_RAT", "mass": { "chemical_mass": 17712.0, "monoisotopic_mass": 17712.0 }, "refseq": { "ac": "NP_001015011", "name": "interleukin-17F precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001015011" }, "gene_names": [ { "name": "Il17f", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q5BJ95", "id": "Q5BJ95" }, { "name": "IL-17F", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001015011", "id": "NP_001015011" }, { "name": "Il17f", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001015011", "id": "NP_001015011" } ], "protein_names": [ { "name": "Interleukin-17F", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q5BJ95" }, { "name": "IL-17F", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q5BJ95" }, { "name": "interleukin-17F precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001015011", "id": "NP_001015011" } ], "function": [ { "annotation": "Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity. IL17A-IL17F signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL17RA and IL17RC chains with TRAF3IP2 adapter through SEFIR domains. This leads to downstream TRAF6-mediated activation of NF-kappa-B and MAPkinase pathways ultimately resulting in transcriptional activation of cytokines, chemokines, antimicrobial peptides and matrix metalloproteinases, with potential strong immune inflammation. IL17A-IL17F is primarily involved in host defense against extracellular bacteria and fungi by inducing neutrophilic inflammation. As signature effector cytokine of T-helper 17 cells (Th17), primarily induces neutrophil activation and recruitment at infection and inflammatory sites. Stimulates the production of antimicrobial beta-defensins DEFB1, DEFB103A, and DEFB104A by mucosal epithelial cells, limiting the entry of microbes through the epithelial barriers. IL17F homodimer can signal via IL17RC homodimeric receptor complex, triggering downstream activation of TRAF6 and NF-kappa-B signaling pathway. Via IL17RC induces transcriptional activation of IL33, a potent cytokine that stimulates group 2 innate lymphoid cells and adaptive T-helper 2 cells involved in pulmonary allergic response to fungi. Likely via IL17RC, promotes sympathetic innervation of peripheral organs by coordinating the communication between gamma-delta T cells and parenchymal cells. Stimulates sympathetic innervation of thermogenic adipose tissue by driving TGFB1 expression. Regulates the composition of intestinal microbiota and immune tolerance by inducing antimicrobial proteins that specifically control the growth of commensal Firmicutes and Bacteroidetes.", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95#function" }, { "database": "UniProtKB", "id": "Q7TNI7", "url": "https://www.uniprot.org/uniprot/Q7TNI7#function" }, { "database": "UniProtKB", "id": "Q96PD4", "url": "https://www.uniprot.org/uniprot/Q96PD4#function" } ] }, { "annotation": "Important mediator of increased endothelial permeability", "evidence": [ { "database": "RefSeq", "id": "NP_001015011", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001015011" }, { "database": "PubMed", "id": "19577259", "url": "https://glygen.org/publication/PubMed/19577259" } ] }, { "annotation": "Increased RORgammat and IL-17F levels contribute to Spontaneously Hypertensive Rat hypertension and might be therapeutic targets", "evidence": [ { "database": "RefSeq", "id": "NP_001015011", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001015011" }, { "database": "PubMed", "id": "28093217", "url": "https://glygen.org/publication/PubMed/28093217" } ] }, { "annotation": "These data suggested that IL-17A and IL-17F maybe play an important role in lipopolysaccharide-induced acute lung injury via autocrine and paracrine mechanisms.", "evidence": [ { "database": "RefSeq", "id": "NP_001015011", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001015011" }, { "database": "PubMed", "id": "24548428", "url": "https://glygen.org/publication/PubMed/24548428" } ] } ], "disease": [ { "disease_id": "DOID:2058", "recommended_name": { "id": "DOID:2058", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2058", "name": "chronic mucocutaneous candidiasis", "description": "A candidiasis that refers to a heterogeneous group of disorders characterized by recurrent or persistent superficial fungal infections located_in skin, located_in mucous membrane, or located_in nail due to T-cell defects, has-agent Candida species and has_symptom scaling of skin lesions, has_symptom thickening of nails, has_symptom swollen periungal tissue, and has_symptom scarring of the scalp." }, "synonyms": [ { "id": "MONDO:0011880", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011880", "name": "candidiasis, familial, 3", "description": "" }, { "id": "MONDO:0011880", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011880", "name": "CANDF3", "description": "" }, { "id": "MONDO:0011880", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011880", "name": "candidiasis, familial, 3", "description": "" }, { "id": "MONDO:0011880", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011880", "name": "Fcnc", "description": "" }, { "id": "MONDO:0011880", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011880", "name": "candidiasis, familial chronic nail, with Icam1 deficiency", "description": "" }, { "id": "MONDO:0007257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007257", "name": "candidiasis, familial, 1", "description": "" }, { "id": "MONDO:0007257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007257", "name": "CANDF1", "description": "" }, { "id": "MONDO:0007257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007257", "name": "candidiasis, familial, 1", "description": "" }, { "id": "MONDO:0007257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007257", "name": "candidiasis, familial, 1, autosomal dominant", "description": "" }, { "id": "MONDO:0007257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007257", "name": "Cmct", "description": "" }, { "id": "MONDO:0007257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007257", "name": "candidiasis, familial chronic mucocutaneous, autosomal dominant, with or without thyroid disease", "description": "" }, { "id": "MONDO:0014230", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014230", "name": "candidiasis, familial, 8", "description": "Any chronic mucocutaneous candidiasis in which the cause of the disease is a mutation in the TRAF3IP2 gene." }, { "id": "MONDO:0014230", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014230", "name": "TRAF3IP2 chronic mucocutaneous candidiasis (disease)", "description": "" }, { "id": "MONDO:0014230", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014230", "name": "candidiasis, familial, 8", "description": "" }, { "id": "MONDO:0014230", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014230", "name": "candidiasis, familial, type 8", "description": "" }, { "id": "MONDO:0014230", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014230", "name": "chronic mucocutaneous candidiasis (disease) caused by mutation in TRAF3IP2", "description": "" }, { "id": "MONDO:0014230", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014230", "name": "CANDF8", "description": "" }, { "id": "MONDO:0014230", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014230", "name": "candidiasis, familial chronic mucocutaneous, autosomal recessive", "description": "" }, { "id": "MONDO:0013140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013140", "name": "candidiasis, familial, 4", "description": "Any familial chronic mucocutaneous candidiasis in which the cause of the disease is a mutation in the CLEC7A gene." }, { "id": "MONDO:0013140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013140", "name": "CLEC7A familial chronic mucocutaneous candidiasis", "description": "" }, { "id": "MONDO:0013140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013140", "name": "candidiasis, familial, 4", "description": "" }, { "id": "MONDO:0013140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013140", "name": "candidiasis, familial, 4, autosomal recessive", "description": "" }, { "id": "MONDO:0013140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013140", "name": "candidiasis, familial, type 4", "description": "" }, { "id": "MONDO:0013140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013140", "name": "familial chronic mucocutaneous candidiasis caused by mutation in CLEC7A", "description": "" }, { "id": "MONDO:0013140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013140", "name": "CANDF4", "description": "" }, { "id": "MONDO:0013140", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013140", "name": "candidiasis, familial chronic mucocutaneous", "description": "" }, { "id": "MONDO:0014642", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014642", "name": "candidiasis, familial, 9", "description": "Any chronic mucocutaneous candidiasis in which the cause of the disease is a mutation in the IL17RC gene." }, { "id": "MONDO:0014642", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014642", "name": "IL17RC chronic mucocutaneous candidiasis (disease)", "description": "" }, { "id": "MONDO:0014642", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014642", "name": "candidiasis, familial, 9", "description": "" }, { "id": "MONDO:0014642", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014642", "name": "candidiasis, familial, type 9", "description": "" }, { "id": "MONDO:0014642", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014642", "name": "chronic mucocutaneous candidiasis (disease) caused by mutation in IL17RC", "description": "" }, { "id": "MONDO:0014642", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014642", "name": "CANDF9", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "predisposition to invasive fungal disease due to CARD9 deficiency", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "candidiasis, familial, 2, autosomal recessive", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "candidiasis, familial, type 2", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "invasive candidiasis-deep dermatophytosis syndrome", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "CANDF2", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "CARD9 deficiency", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "CARD9 immunodeficiency", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "candidiasis familial chronic mucocutaneous, autosomal recessive", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "candidiasis, familial chronic mucocutaneous, autosomal recessive", "description": "" }, { "id": "MONDO:0008905", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008905", "name": "candidiasis, familial, 2", "description": "" }, { "id": "MONDO:0013503", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013503", "name": "candidiasis, familial, 6", "description": "Any familial chronic mucocutaneous candidiasis in which the cause of the disease is a mutation in the IL17F gene." }, { "id": "MONDO:0013503", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013503", "name": "IL17F familial chronic mucocutaneous candidiasis", "description": "" }, { "id": "MONDO:0013503", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013503", "name": "candidiasis, familial, 6", "description": "" }, { "id": "MONDO:0013503", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013503", "name": "candidiasis, familial, 6, autosomal dominant", "description": "" }, { "id": "MONDO:0013503", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013503", "name": "candidiasis, familial, type 6", "description": "" }, { "id": "MONDO:0013503", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013503", "name": "familial chronic mucocutaneous candidiasis caused by mutation in IL17F", "description": "" }, { "id": "MONDO:0013503", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013503", "name": "CANDF6", "description": "" }, { "id": "MONDO:0013503", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013503", "name": "candidiasis, familial chronic mucocutaneous, autosomal dominant", "description": "" }, { "id": "MIM:615527", "resource": "MIM", "url": "https://www.omim.org/entry/615527", "name": "Candidiasis, familial, 8", "description": "Candidiasis, familial, 8" }, { "id": "MIM:613108", "resource": "MIM", "url": "https://www.omim.org/entry/613108", "name": "Candidiasis, familial, 4", "description": "Candidiasis, familial, 4" }, { "id": "MIM:616445", "resource": "MIM", "url": "https://www.omim.org/entry/616445", "name": "Candidiasis, familial, 9", "description": "Candidiasis, familial, 9" }, { "id": "MIM:212050", "resource": "MIM", "url": "https://www.omim.org/entry/212050", "name": "Immunodeficiency 103, susceptibility to fungal infections", "description": "Immunodeficiency 103, susceptibility to fungal infections" }, { "id": "MIM:613956", "resource": "MIM", "url": "https://www.omim.org/entry/613956", "name": "Candidiasis, familial, 6", "description": "Candidiasis, familial, 6" } ], "evidence": [ { "id": "2058", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2058" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "common_name": "Rat" } ], "gene": [ { "name": "Il17f", "url": "https://www.uniprot.org/uniprot/Q5BJ95", "locus": { "chromosome": "9", "start_pos": 23190100, "end_pos": 23201482, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000012509", "url": "https://www.ensembl.org/id/ENSRNOG00000012509" } ] } } ], "crossref": [ { "id": "ENSRNOG00000012509", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000012509", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "301291", "url": "https://www.ncbi.nlm.nih.gov/gene/301291", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR010345", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010345", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020440", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020440", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029034", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029034", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:301291", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:301291", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "SPWDYNV", "url": "https://omabrowser.org/oma/group/SPWDYNV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5400717at2759", "url": "http://www.orthodb.org/?query=5400717at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PF06083", "url": "http://pfam.xfam.org/family/PF06083", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q5BJ95", "url": "http://purl.obolibrary.org/obo/PR_Q5BJ95", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001015011", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001015011", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1311398", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1311398", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A0H2UHJ7", "url": "https://www.uniprot.org/uniprot/A0A0H2UHJ7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0H2UHJ7-1", "url": "https://www.uniprot.org/uniprot/A0A0H2UHJ7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5BJ95-1", "url": "https://www.uniprot.org/uniprot/Q5BJ95-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKGSCETTMVKSLLLLMLGFAIISSGAARRNPKVGLSALQKAGNCPPLEDNSVRVDIRIFNQNQGISVPRDFQNRSSSPWDYNITRDPDRFPSEIAEAQCRHSGCINAQGQEDGSMNSVPIQQEILVLRREPQGCSNSFRLEKMLIKVGCTCVTPIVHHAA", "length": 161, "header": "sp|Q5BJ95-1|IL17F_RAT Isoform 1 of Interleukin-17F OS=Rattus norvegicus OX=10116 GN=Il17f PE=2 SV=2 CANONICAL=Q5BJ95-1" }, "isoforms": [ { "isoform_ac": "A0A0H2UHJ7-1", "url": "", "sequence": { "sequence": "MVKSLLLLMLGFAIISSGAARRNPKVGLSALQKAGNCPPLEDNSVRVDIRIFNQNQGISVPRDFQNRSSSPWDYNITRDPDRFPSEIAEAQCRHSGCINAQGQEDGSMNSVPIQQEILVLRREPQGCSNSFRLEKMLIKVGCTCVTPIVHHAA", "length": 153, "header": "tr|A0A0H2UHJ7-1|IL17F_RAT Computationally mapped isoform of Interleukin-17F OS=Rattus norvegicus OX=10116 GN=Il17f PE=2 SV=1 CANONICAL=Q5BJ95-1" }, "locus": { "chromosome": "9", "start_pos": 23197187, "end_pos": 23190713, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000016717", "url": "https://www.ensembl.org/id/ENSRNOT00000016717" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000016717", "url": "https://www.ensembl.org/id/ENSRNOP00000016717" } ] } }, { "isoform_ac": "Q5BJ95-1", "url": "", "sequence": { "sequence": "MKGSCETTMVKSLLLLMLGFAIISSGAARRNPKVGLSALQKAGNCPPLEDNSVRVDIRIFNQNQGISVPRDFQNRSSSPWDYNITRDPDRFPSEIAEAQCRHSGCINAQGQEDGSMNSVPIQQEILVLRREPQGCSNSFRLEKMLIKVGCTCVTPIVHHAA", "length": 161, "header": "sp|Q5BJ95-1|IL17F_RAT Isoform 1 of Interleukin-17F OS=Rattus norvegicus OX=10116 GN=Il17f PE=2 SV=2 CANONICAL=Q5BJ95-1" }, "locus": { "chromosome": "9", "start_pos": 23197187, "end_pos": 23190713, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000016717", "url": "https://www.ensembl.org/id/ENSRNOT00000016717" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000016717", "url": "https://www.ensembl.org/id/ENSRNOP00000016717" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 83, "start_aa": "Asn", "end_pos": 83, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn83", "evidence": [ { "id": "Q5BJ95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BJ95#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Interleukin-17F-induced pulmonary microvascular endothelial monolayer hyperpermeability via the protein kinase C pathway.", "journal": "The Journal of surgical research", "date": "2010", "authors": "You QH, Sun GY, Wang N, Shen JL, Wang Y", "evidence": [ { "database": "RefSeq", "id": "NP_001015011", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001015011" } ], "reference": [ { "type": "PubMed", "id": "19577259", "url": "https://glygen.org/publication/PubMed/19577259" } ] }, { "title": "Expression of IL-17A and IL-17F in lipopolysaccharide-induced acute lung injury and the counteraction of anisodamine or methylprednisolone.", "journal": "Cytokine", "date": "2014", "authors": "You QH, Zhang D, Niu CC, Zhu ZM, Wang N, Yue Y, Sun GY", "evidence": [ { "database": "RefSeq", "id": "NP_001015011", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001015011" } ], "reference": [ { "type": "PubMed", "id": "24548428", "url": "https://glygen.org/publication/PubMed/24548428" } ] }, { "title": "Abnormal CD161(+) immune cells and retinoic acid receptor-related orphan receptor gammat-mediate enhanced IL-17F expression in the setting of genetic hypertension.", "journal": "The Journal of allergy and clinical immunology", "date": "2017", "authors": "Singh MV, Cicha MZ, Kumar S, Meyerholz DK, Irani K, Chapleau MW, Abboud FM", "evidence": [ { "database": "RefSeq", "id": "NP_001015011", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001015011" } ], "reference": [ { "type": "PubMed", "id": "28093217", "url": "https://glygen.org/publication/PubMed/28093217" } ] } ], "pathway": [ { "id": "rno:301291", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:301291", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q7TNI7-1", "protein_name": "Interleukin-17F", "gene_name": "Il17f", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKCTRETAMVKSLLLLMLGLAILREVAARKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA", "length": 161 }, "evidence": [ { "id": "45227954", "url": "http://www.informatics.jax.org/homology/45227954", "database": "MGI" }, { "id": "Q5BJ95", "url": "https://omabrowser.org/oma/group/Q5BJ95/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q96PD4-1", "protein_name": "Interleukin-17F", "gene_name": "IL17F", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ", "length": 163 }, "evidence": [ { "id": "45227954", "url": "http://www.informatics.jax.org/homology/45227954", "database": "MGI" }, { "id": "Q5BJ95", "url": "https://omabrowser.org/oma/group/Q5BJ95/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 20, "go_terms": [ { "name": "regulation of transforming growth factor beta receptor signaling pathway", "id": "GO:0017015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017015", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "defense response to Gram-negative bacterium", "id": "GO:0050829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050829", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "defense response to Gram-positive bacterium", "id": "GO:0050830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050830", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "positive regulation of interleukin-6 production", "id": "GO:0032755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032755", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "negative regulation of angiogenesis", "id": "GO:0016525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016525", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "cartilage development", "id": "GO:0051216", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051216", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "regulation of interleukin-8 production", "id": "GO:0032677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032677", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "positive regulation of cytokine production involved in inflammatory response", "id": "GO:1900017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900017", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "positive regulation of chemokine (C-X-C motif) ligand 1 production", "id": "GO:2000340", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000340", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "interleukin-17-mediated signaling pathway", "id": "GO:0097400", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097400", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "regulation of granulocyte macrophage colony-stimulating factor production", "id": "GO:0032645", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032645", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "positive regulation of lymphotoxin A production", "id": "GO:0032761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032761", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "positive regulation of antimicrobial peptide production", "id": "GO:0002225", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002225", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "regulation of interleukin-2 production", "id": "GO:0032663", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032663", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "positive regulation of cytokine production", "id": "GO:0001819", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001819", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "regulation of interleukin-6 production", "id": "GO:0032675", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032675", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "adaptive immune response", "id": "GO:0002250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "cytokine binding", "id": "GO:0019955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019955", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" }, { "name": "cytokine receptor binding", "id": "GO:0005126", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005126", "evidence": [ { "database": "UniProtKB", "id": "Q5BJ95", "url": "https://www.uniprot.org/uniprot/Q5BJ95" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 74, "end_pos": 76, "annotation": "n_glycosylation_sequon" }, { "start_pos": 83, "end_pos": 85, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }