{ "uniprot_canonical_ac": "Q571G4-1", "uniprot_ac": "Q571G4", "uniprot_id": "LIN54_MOUSE", "mass": { "chemical_mass": 79566.0, "monoisotopic_mass": 79566.0 }, "refseq": { "ac": "NP_001108482", "name": "protein lin-54 homolog isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001108482" }, "gene_names": [ { "name": "Lin54", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q571G4", "id": "Q571G4" }, { "name": "Kiaa2037", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q571G4", "id": "Q571G4" }, { "name": "Lin54", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001108482", "id": "NP_001108482" } ], "protein_names": [ { "name": "Protein lin-54 homolog", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q571G4" }, { "name": "protein lin-54 homolog isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001108482", "id": "NP_001108482" }, { "name": "protein lin-54 homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001108482", "id": "NP_001108482" } ], "function": [ { "annotation": "Component of the DREAM complex, a multiprotein complex that can both act as a transcription activator or repressor depending on the context. In G0 phase, the complex binds to more than 800 promoters and is required for repression of E2F target genes. In S phase, the complex selectively binds to the promoters of G2/M genes whose products are required for mitosis and participates in their cell cycle dependent activation. In the complex, acts as a DNA-binding protein that binds the promoter of CDK1 in a sequence-specific manner. Specifically recognizes the consensus motif 5'-TTYRAA-3' in target DNA.", "evidence": [ { "database": "UniProtKB", "id": "Q571G4", "url": "https://www.uniprot.org/uniprot/Q571G4#function" }, { "database": "UniProtKB", "id": "Q6MZP7", "url": "https://www.uniprot.org/uniprot/Q6MZP7#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q571G4", "url": "https://www.uniprot.org/uniprot/Q571G4" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Lin54", "url": "https://www.uniprot.org/uniprot/Q571G4", "locus": { "chromosome": "5", "start_pos": 100589900, "end_pos": 100648493, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000118665", "url": "https://www.ensembl.org/id/ENSMUSG00000118665" } ] } } ], "crossref": [ { "id": "231506", "url": "https://www.ncbi.nlm.nih.gov/gene/231506", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q571G4", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q571G4*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR005172", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005172", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028307", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028307", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033467", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033467", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:231506", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:231506", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2140902", "url": "http://www.informatics.jax.org/marker/MGI:2140902", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q571G4", "url": "https://oglcnac.org/atlas/detail/Q571G4", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "Q571G4", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q571G4", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "XKPVVVN", "url": "https://omabrowser.org/oma/group/XKPVVVN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "402190at2759", "url": "http://www.orthodb.org/?query=402190at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12446", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12446", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12446:SF36", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12446:SF36", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03638", "url": "http://pfam.xfam.org/family/PF03638", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q571G4", "url": "http://purl.obolibrary.org/obo/PR_Q571G4", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-1538133", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1538133", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001108482", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001108482", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A7P0A153", "url": "https://www.uniprot.org/uniprot/A0A7P0A153", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0A153-1", "url": "https://www.uniprot.org/uniprot/A0A7P0A153-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q571G4", "url": "https://www.uniprot.org/uniprot/Q571G4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q571G4-1", "url": "https://www.uniprot.org/uniprot/Q571G4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q571G4-2", "url": "https://www.uniprot.org/uniprot/Q571G4-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q571G4-3", "url": "https://www.uniprot.org/uniprot/Q571G4-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEVVPAEVNSLLPDDIMDTAITLVDEDSIEAVIVSSPIPMETELEEIVNINSTGDSTATPISTEPITVYSNHTNQVAVNTTVSKADSNTTVKPAFPSGLQKLGAQTPVTISANQIILNKVSQTSDLKLGNQTLKPDGQKLILTTLGKSGSPIVLALPHSQLPQAQKVTAQAQPGDAKLPPQQIKVVTIGGRPEVKPVIGVSALTPGSQLINTTTQPSVLQTQQLKTVQIAKKPRTPTSGPVITKLIFAKPINSKAVTGQTTQASPPVVTGRVLSQSTPGTPSKTITISESGVIGSTLNSTTQTPNKIAISPLKSPNKTVKSAVQTITVGGMSTSQFKTIIPLATAPNVQQIQVPGSKFHYVRLVTATTASSSAQPVSQSPSVNTQPLQQAKPVVVNTTPVRMSVPFVQAQAVKQVVPKPINSTSQIVTTSQPQQRLIMPATPLPQIQPNLTNLPPGTVLAPAPGTGNVGYAVLPAQYVTQLQQSSYVSIASNSNFTGTSGIQTQARLPFNGIIPSESTSRPRKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSAGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKAKSDPCAMHC", "length": 749, "header": "sp|Q571G4-1|LIN54_MOUSE Isoform 1 of Protein lin-54 homolog OS=Mus musculus OX=10090 GN=Lin54 PE=2 SV=2 CANONICAL=Q571G4-1" }, "isoforms": [ { "isoform_ac": "A0A7P0A153-1", "url": "", "sequence": { "sequence": "MEVVPAEIAKKPRTPTSGPVITKLIFAKPINSKAVTGQTTQASPPVVTGRVLSQSTPGTPSKTITISESGVIGSTLNSTTQTPNKIAISPLKSPNKNN", "length": 98, "header": "tr|A0A7P0A153-1|LIN54_MOUSE Computationally mapped isoform of Protein lin-54 homolog OS=Mus musculus OX=10090 GN=Lin54 PE=2 SV=1 CANONICAL=Q571G4-1" }, "locus": { "chromosome": "5", "start_pos": 100633682, "end_pos": 100617777, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000239514.1", "url": "https://www.ensembl.org/id/ENSMUST00000239514.1" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000159393.2", "url": "https://www.ensembl.org/id/ENSMUSP00000159393.2" } ] } }, { "isoform_ac": "Q571G4-1", "url": "", "sequence": { "sequence": "MEVVPAEVNSLLPDDIMDTAITLVDEDSIEAVIVSSPIPMETELEEIVNINSTGDSTATPISTEPITVYSNHTNQVAVNTTVSKADSNTTVKPAFPSGLQKLGAQTPVTISANQIILNKVSQTSDLKLGNQTLKPDGQKLILTTLGKSGSPIVLALPHSQLPQAQKVTAQAQPGDAKLPPQQIKVVTIGGRPEVKPVIGVSALTPGSQLINTTTQPSVLQTQQLKTVQIAKKPRTPTSGPVITKLIFAKPINSKAVTGQTTQASPPVVTGRVLSQSTPGTPSKTITISESGVIGSTLNSTTQTPNKIAISPLKSPNKTVKSAVQTITVGGMSTSQFKTIIPLATAPNVQQIQVPGSKFHYVRLVTATTASSSAQPVSQSPSVNTQPLQQAKPVVVNTTPVRMSVPFVQAQAVKQVVPKPINSTSQIVTTSQPQQRLIMPATPLPQIQPNLTNLPPGTVLAPAPGTGNVGYAVLPAQYVTQLQQSSYVSIASNSNFTGTSGIQTQARLPFNGIIPSESTSRPRKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSAGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKAKSDPCAMHC", "length": 749, "header": "sp|Q571G4-1|LIN54_MOUSE Isoform 1 of Protein lin-54 homolog OS=Mus musculus OX=10090 GN=Lin54 PE=2 SV=2 CANONICAL=Q571G4-1" }, "locus": { "chromosome": "5", "start_pos": 100633682, "end_pos": 100591938, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000239513", "url": "https://www.ensembl.org/id/ENSMUST00000239513" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000159392", "url": "https://www.ensembl.org/id/ENSMUSP00000159392" } ] } }, { "isoform_ac": "Q571G4-2", "url": "", "sequence": { "sequence": "MSTSQFKTIIPLATAPNVQQIQVPGSKFHYVRLVTATTASSSAQPVSQSPSVNTQPLQQAKPVVVNTTPVRMSVPFVQAQAVKQVVPKPINSTSQIVTTSQPQQRLIMPATPLPQIQPNLTNLPPGTVLAPAPGTGNVGYAVLPAQYVTQLQQSSYVSIASNSNFTGTSGIQTQARLPFNGIIPSESTSRPRKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSAGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKAKSDPCAMHC", "length": 419, "header": "sp|Q571G4-2|LIN54_MOUSE Isoform 2 of Protein lin-54 homolog OS=Mus musculus OX=10090 GN=Lin54 PE=2 SV=2 CANONICAL=Q571G4-1" }, "locus": {} }, { "isoform_ac": "Q571G4-3", "url": "", "sequence": { "sequence": "MEVVPAEVNSLLPDDIMDTAITLVDEDSIEAVIVSSPIPMETELEEIVNINSTGDSTATPISTEPITVYSNHTNQVAVNTTVSKADSNTTVKPAFPSGLQKLGAQTPVTISANQIILNKVSQTSDLKLGNQTLKPDGQKLILTTLGKSGSPIVLALPHSQLPQAQKVTAQAQPGDAKLPPQQIKVVTIGGRPEVKPVIGVSALTPGSQLINTTTQPSVLQTQQLKTVQVKTKKGHIT", "length": 237, "header": "sp|Q571G4-3|LIN54_MOUSE Isoform 3 of Protein lin-54 homolog OS=Mus musculus OX=10090 GN=Lin54 PE=2 SV=2 CANONICAL=Q571G4-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 106, "start_aa": "Thr", "end_pos": 106, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr106", "evidence": [ { "id": "Q571G4", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q571G4" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" }, { "id": "35822049", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35822049" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" }, { "id": "Q571G4", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q571G4" }, { "id": "32782141", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32782141" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 109, "start_aa": "Thr", "end_pos": 109, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr109", "evidence": [ { "id": "Q571G4", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q571G4" }, { "id": "32782141", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32782141" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 111, "start_aa": "Ser", "end_pos": 111, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser111", "evidence": [ { "id": "Q571G4", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q571G4" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 235, "start_aa": "Thr", "end_pos": 235, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr235", "evidence": [ { "id": "Q571G4", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q571G4" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" }, { "id": "35822049", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35822049" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 238, "start_aa": "Ser", "end_pos": 238, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser238", "evidence": [ { "id": "Q571G4", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q571G4" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 257, "start_aa": "Thr", "end_pos": 257, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr257", "evidence": [ { "id": "Q571G4", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q571G4" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" }, { "id": "35822049", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35822049" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 260, "start_aa": "Thr", "end_pos": 260, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr260", "evidence": [ { "id": "Q571G4", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q571G4" }, { "id": "32782141", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32782141" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 261, "start_aa": "Thr", "end_pos": 261, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr261", "evidence": [ { "id": "Q571G4", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q571G4" }, { "id": "32782141", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32782141" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 274, "start_aa": "Ser", "end_pos": 274, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser274", "evidence": [ { "id": "Q571G4", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q571G4" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" }, { "id": "35822049", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35822049" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 276, "start_aa": "Ser", "end_pos": 276, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser276", "evidence": [ { "id": "Q571G4", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q571G4" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" }, { "id": "35822049", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35822049" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" }, { "id": "Q571G4", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q571G4" }, { "id": "32782141", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32782141" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 277, "start_aa": "Thr", "end_pos": 277, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr277", "evidence": [ { "id": "Q571G4", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q571G4" }, { "id": "32782141", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32782141" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 344, "start_aa": "Thr", "end_pos": 344, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr344", "evidence": [ { "id": "Q571G4", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q571G4" }, { "id": "29237092", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29237092" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 365, "start_aa": "Thr", "end_pos": 365, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr365", "evidence": [ { "id": "Q571G4", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q571G4" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" }, { "id": "35822049", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35822049" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 367, "start_aa": "Thr", "end_pos": 367, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr367", "evidence": [ { "id": "Q571G4", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q571G4" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" }, { "id": "35822049", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35822049" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 368, "start_aa": "Thr", "end_pos": 368, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr368", "evidence": [ { "id": "Q571G4", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q571G4" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" }, { "id": "35822049", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35822049" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 371, "start_aa": "Ser", "end_pos": 371, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser371", "evidence": [ { "id": "Q571G4", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q571G4" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" }, { "id": "35822049", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35822049" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 372, "start_aa": "Ser", "end_pos": 372, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser372", "evidence": [ { "id": "Q571G4", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q571G4" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" }, { "id": "35822049", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35822049" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 429, "start_aa": "Thr", "end_pos": 429, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr429", "evidence": [ { "id": "Q571G4", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q571G4" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" }, { "id": "35822049", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35822049" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" } ] } ], "phosphorylation": [ { "start_pos": 264, "end_pos": 264, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q571G4", "url": "https://www.uniprot.org/uniprot/Q571G4" } ], "site_lbl": "Ser264" }, { "start_pos": 282, "end_pos": 282, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q571G4", "url": "https://www.uniprot.org/uniprot/Q571G4" } ], "site_lbl": "Ser282" }, { "start_pos": 310, "end_pos": 310, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q571G4", "url": "https://www.uniprot.org/uniprot/Q571G4" } ], "site_lbl": "Ser310" }, { "start_pos": 314, "end_pos": 314, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q571G4", "url": "https://www.uniprot.org/uniprot/Q571G4" } ], "site_lbl": "Ser314" }, { "start_pos": 635, "end_pos": 635, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q571G4", "url": "https://www.uniprot.org/uniprot/Q571G4" } ], "site_lbl": "Ser635" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "O-GlcNAcylation is required for B cell homeostasis and antibody responses.", "journal": "Nature communications", "date": "2017", "authors": "Wu JL, Chiang MF, Hsu PH, Tsai DY, Hung KH, Wang YH, Angata T, Lin KI", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q571G4", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q571G4" } ], "reference": [ { "type": "PubMed", "id": "29187734", "url": "https://glygen.org/publication/PubMed/29187734" } ] }, { "title": "Artificial Cysteine S-Glycosylation Induced by Per-O-Acetylated Unnatural Monosaccharides during Metabolic Glycan Labeling.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2018", "authors": "Qin W, Qin K, Fan X, Peng L, Hong W, Zhu Y, Lv P, Du Y, Huang R, Han M, Cheng B, Liu Y, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "Q571G4", "url": "https://oglcnac.org/atlas/detail/Q571G4" } ], "reference": [ { "type": "PubMed", "id": "29237092", "url": "https://glygen.org/publication/PubMed/29237092" } ] }, { "title": "Cytosolic N-GlcNAc proteins are formed by the action of endo-beta-N-acetylglucosaminidase.", "journal": "Biochemical and biophysical research communications", "date": "2020", "authors": "Maynard JC, Fujihira H, Dolgonos GE, Suzuki T, Burlingame AL", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "Q571G4", "url": "https://oglcnac.org/atlas/detail/Q571G4" } ], "reference": [ { "type": "PubMed", "id": "32782141", "url": "https://glygen.org/publication/PubMed/32782141" } ] }, { "title": "Age-related loss of neural stem cell O-GlcNAc promotes a glial fate switch through STAT3 activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "White CW 3rd, Fan X, Maynard JC, Wheatley EG, Bieri G, Couthouis J, Burlingame AL, Villeda SA", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "Q571G4", "url": "https://oglcnac.org/atlas/detail/Q571G4" } ], "reference": [ { "type": "PubMed", "id": "32848054", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "title": "Defining the Dynamic Regulation of O-GlcNAc Proteome in the Mouse Cortex---the O-GlcNAcylation of Synaptic and Trafficking Proteins Related to Neurodegenerative Diseases.", "journal": "Frontiers in aging", "date": "2021", "authors": "Huynh Van N, Wang Sheng, Ouyang Xiaosen, Wani Willayat Y, Johnson Michelle S, Chacko Balu K, Jegga Anil G, Qian Wei-Jun, Chatham John C, Darley-Usmar Victor M, Zhang Jianhua", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q571G4", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q571G4" } ], "reference": [ { "type": "PubMed", "id": "35822049", "url": "https://glygen.org/publication/PubMed/35822049" } ] }, { "title": "Chemoproteomic and Transcriptomic Analysis Reveals that O-GlcNAc Regulates Mouse Embryonic Stem Cell Fate through the Pluripotency Network.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2023-02-27", "authors": "Hao Yi, Li Xiang, Qin Ke, Shi Yujie, He Yanwen, Zhang Che, Cheng Bo, Zhang Xiwen, Hu Guangyu, Liang Shuyu, Tang Qi, Chen Xing", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q571G4", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q571G4" } ], "reference": [ { "type": "PubMed", "id": "36852467", "url": "https://glygen.org/publication/PubMed/36852467" } ] } ], "pathway": [ { "id": "mmu:231506", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:231506", "resource": "KEGG Pathway" }, { "id": "R-MMU-1538133", "name": "G0 and Early G1", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1538133", "resource": "Reactome", "description": "G0 and Early G1" } ], "orthologs": [ { "uniprot_canonical_ac": "Q641Z1-1", "protein_name": "Protein lin-54 homolog", "gene_name": "Lin54", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEVVPAEVNSLLPDDIMDTAITLVDEDSIEAVIVSSPIPMETELEEIVSINSTGDSTATPISTEPITVYSNHTNQVAVNTTVSKADSNTTVKPAFPSGLQKLGAQTPVTISANQIILNKVSQTSDLKLGNQTLKPDGQKLILTTLGKSGSPIVLALPHSQLPQAQKVTAQAQPGDAKLPPQQIKVVTIGGRPEVKPAIGVSALTPGSQLINTTTQPSVLQTQQLKTVQIAKKPRTPTSGPVITKLIFAKPINSKAVTGQTTQASPPVVTGRVLSQSAPGTPSKTITISESGVIGSTLNSTTQTPNKIAISPLKSPNKTVKSAVQTITVGGMSTSQFKTIIPLAAAPNVQPIQVPGSKFHYVRLVTATTAGSSAPPVSQSPSVNTQPLQQAKPVVVNTTPVRMSVPFVQAQAVKQVVPKPINSTSQIVTTSQPQQRLIMPATPLPQIQPNLTNLPPGTVLAPAPGTGNVGYAVLPAQYVTQLQQSSYVSIAGNSNFTGTSGIQTQARVSFNGIIPSESASRPRKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKAKSDPCAMHC", "length": 749 }, "evidence": [ { "id": "45234197", "url": "http://www.informatics.jax.org/homology/45234197", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6MZP7-1", "protein_name": "Protein lin-54 homolog", "gene_name": "LIN54", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEVVPAEVNSLLPEEIMDTGITLVDDDSIEAVIVSSPIPMETELEEIVNINSTGDSTATPISTEPITVYSNHTNQVAVNTTITKADSNTTVKPAFPSGLQKLGAQTPVTISANQIILNKVSQTSDLKLGNQTLKPDGQKLILTTLGKSGSPIVLALPHSQLPQAQKVTTQAQSGDAKLPPQQIKVVTIGGRPEVKPVIGVSALTPGSQLINTTTQPSVLQTQQLKTVQIAKKPRTPTSGPVITKLIFAKPINSKAVTGQTTQVSPPVIAGRVLSQSTPGTPSKTITISESGVIGSTLNSTTQTPNKIAISPLKSPNKAVKSTVQTITVGGVSTSQFKTIIPLATAPNVQQIQVPGSKFHYVRLVTATSASSSTQPVSQNPSTNTQPLQQAKPVVVNTTPVRMSVPIVSAQAVKQVVPKPINPTSQIVTTSQPQQRLIMPATPLPQIQPNLTNLPPGTVLAPAPGTGNVGYAVLPAQYVTQLQQSSYVSIASNSTFTGTSGIQTQARLPFNGIIPSESASRPRKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKAKSDPCAMNC", "length": 749 }, "evidence": [ { "id": "45234197", "url": "http://www.informatics.jax.org/homology/45234197", "database": "MGI" }, { "id": "Q571G4", "url": "https://omabrowser.org/oma/group/Q571G4/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "minor groove of adenine-thymine-rich DNA binding", "id": "GO:0003680", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003680", "evidence": [ { "database": "UniProtKB", "id": "Q571G4", "url": "https://www.uniprot.org/uniprot/Q571G4" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q571G4", "url": "https://www.uniprot.org/uniprot/Q571G4" } ], "pmid": "" }, { "name": "transcription regulatory region nucleic acid binding", "id": "GO:0001067", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001067", "evidence": [ { "database": "UniProtKB", "id": "Q571G4", "url": "https://www.uniprot.org/uniprot/Q571G4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "nucleosome organization", "id": "GO:0034728", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034728", "evidence": [ { "database": "UniProtKB", "id": "Q571G4", "url": "https://www.uniprot.org/uniprot/Q571G4" } ], "pmid": "" }, { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "Q571G4", "url": "https://www.uniprot.org/uniprot/Q571G4" } ], "pmid": "" }, { "name": "cell cycle", "id": "GO:0007049", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007049", "evidence": [ { "database": "UniProtKB", "id": "Q571G4", "url": "https://www.uniprot.org/uniprot/Q571G4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q571G4", "url": "https://www.uniprot.org/uniprot/Q571G4" } ], "pmid": "" }, { "name": "RNA polymerase II transcription repressor complex", "id": "GO:0090571", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090571", "evidence": [ { "database": "UniProtKB", "id": "Q571G4", "url": "https://www.uniprot.org/uniprot/Q571G4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 130, "end_pos": 132, "annotation": "n_glycosylation_sequon" }, { "start_pos": 211, "end_pos": 213, "annotation": "n_glycosylation_sequon" }, { "start_pos": 298, "end_pos": 300, "annotation": "n_glycosylation_sequon" }, { "start_pos": 316, "end_pos": 318, "annotation": "n_glycosylation_sequon" }, { "start_pos": 396, "end_pos": 398, "annotation": "n_glycosylation_sequon" }, { "start_pos": 421, "end_pos": 423, "annotation": "n_glycosylation_sequon" }, { "start_pos": 449, "end_pos": 451, "annotation": "n_glycosylation_sequon" }, { "start_pos": 494, "end_pos": 496, "annotation": "n_glycosylation_sequon" }, { "start_pos": 51, "end_pos": 53, "annotation": "n_glycosylation_sequon" }, { "start_pos": 526, "end_pos": 528, "annotation": "n_glycosylation_sequon" }, { "start_pos": 550, "end_pos": 552, "annotation": "n_glycosylation_sequon" }, { "start_pos": 71, "end_pos": 73, "annotation": "n_glycosylation_sequon" }, { "start_pos": 79, "end_pos": 81, "annotation": "n_glycosylation_sequon" }, { "start_pos": 88, "end_pos": 90, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 18 }, { "field": "total_sites", "count": 18 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 18 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 18 }, { "field": "total_sites", "count": 18 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 18 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }