{ "uniprot_canonical_ac": "Q56UD9-1", "uniprot_ac": "Q56UD9", "uniprot_id": "NPBW1_RAT", "mass": { "chemical_mass": 36306.0, "monoisotopic_mass": 36306.0 }, "refseq": {}, "gene_names": [ { "name": "Npbwr1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q56UD9", "id": "Q56UD9" }, { "name": "Gpr7", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q56UD9", "id": "Q56UD9" } ], "protein_names": [ { "name": "Neuropeptides B/W receptor type 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q56UD9" }, { "name": "G-protein coupled receptor 7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q56UD9" } ], "function": [ { "annotation": "Interacts specifically with a number of opioid ligands. Receptor for neuropeptides B and W, which may be involved in neuroendocrine system regulation, food intake and the organization of other signals (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q56UD9", "url": "https://www.uniprot.org/uniprot/Q56UD9#function" } ] } ], "disease": [ { "disease_id": "DOID:14330", "recommended_name": { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "Parkinson's disease", "description": "A synucleinopathy that has_material_basis_in degeneration of the central nervous system that often impairs motor skills, speech, and other functions." }, "synonyms": [ { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "Parkinson disease", "description": "" }, { "id": "DOID:14330", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14330", "name": "paralysis agitans", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "A Parkinson disease that begins after around the age of 50." }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "LOPD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PARK", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "PD", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, age of onset, modifier, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, late-onset, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "Parkinson disease, susceptibility to, Multifactorial", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "autosomal dominant late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "hereditary late-onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late onset Parkinson's disease", "description": "" }, { "id": "MONDO:0008199", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008199", "name": "late-onset Parkinson disease", "description": "" }, { "id": "MIM:168600", "resource": "MIM", "url": "https://www.omim.org/entry/168600", "name": "Parkinson disease", "description": "Parkinson disease" } ], "evidence": [ { "id": "14330", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:14330" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q56UD9", "url": "https://www.uniprot.org/uniprot/Q56UD9" } ], "common_name": "Rat" } ], "gene": [ { "name": "Npbwr1", "url": "https://www.uniprot.org/uniprot/Q56UD9", "locus": { "chromosome": "5", "start_pos": 13496415, "end_pos": 13495426, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000007640", "url": "https://www.ensembl.org/id/ENSRNOG00000007640" } ] } } ], "crossref": [ { "id": "cd15087", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15087", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009150", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009150", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:297795", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:297795", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PESVWWK", "url": "https://omabrowser.org/oma/group/PESVWWK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5393360at2759", "url": "http://www.orthodb.org/?query=5393360at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24229", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24229", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24229:SF47", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24229:SF47", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00001", "url": "http://pfam.xfam.org/family/PF00001", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q56UD9", "url": "http://purl.obolibrary.org/obo/PR_Q56UD9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-375276", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-375276", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-418594", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "1305917", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1305917", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "Q56UD9", "url": "https://www.uniprot.org/uniprot/Q56UD9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q56UD9-1", "url": "https://www.uniprot.org/uniprot/Q56UD9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MHNLSLFEPGRGNVSCGGPFLGCPNESNPAPLPLPQPLAVAVPVVYGVICAVGLAGNSAVLYVLLRTPRMKTVTNVFILNLAIADELFTLVLPINIADFLLRRWPFGEVMCKLIVAVDQYNTFSSLYFLAVMSADRYLVVLATAESRRVSGRTYGAARAVSLAVWALVTLVVLPFAVFARLDEEQGRRQCVLVFPQPEAFWWRASRLYTLVLGFAIPVSTICALYITLLCRLRAIQLDSHAKALDRAKKRVTLLVVAILAVCLLCWTPYHLSTIVALTTDLPQTPLVIGISYFITSLSYANSCLNPFLYAFLDDSFRRSLRQLVSCRTA", "length": 329, "header": "sp|Q56UD9-1|NPBW1_RAT Isoform 1 of Neuropeptides B/W receptor type 1 OS=Rattus norvegicus OX=10116 GN=Npbwr1 PE=2 SV=1 CANONICAL=Q56UD9-1" }, "isoforms": [ { "isoform_ac": "Q56UD9-1", "url": "", "sequence": { "sequence": "MHNLSLFEPGRGNVSCGGPFLGCPNESNPAPLPLPQPLAVAVPVVYGVICAVGLAGNSAVLYVLLRTPRMKTVTNVFILNLAIADELFTLVLPINIADFLLRRWPFGEVMCKLIVAVDQYNTFSSLYFLAVMSADRYLVVLATAESRRVSGRTYGAARAVSLAVWALVTLVVLPFAVFARLDEEQGRRQCVLVFPQPEAFWWRASRLYTLVLGFAIPVSTICALYITLLCRLRAIQLDSHAKALDRAKKRVTLLVVAILAVCLLCWTPYHLSTIVALTTDLPQTPLVIGISYFITSLSYANSCLNPFLYAFLDDSFRRSLRQLVSCRTA", "length": 329, "header": "sp|Q56UD9-1|NPBW1_RAT Isoform 1 of Neuropeptides B/W receptor type 1 OS=Rattus norvegicus OX=10116 GN=Npbwr1 PE=2 SV=1 CANONICAL=Q56UD9-1" }, "locus": { "chromosome": "5", "start_pos": 13496412, "end_pos": 13495426, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000010032", "url": "https://www.ensembl.org/id/ENSRNOT00000010032" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000010032", "url": "https://www.ensembl.org/id/ENSRNOP00000010032" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 13, "start_aa": "Asn", "end_pos": 13, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn13", "evidence": [ { "id": "Q56UD9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q56UD9#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 25, "start_aa": "Asn", "end_pos": 25, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn25", "evidence": [ { "id": "Q56UD9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q56UD9#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 3, "start_aa": "Asn", "end_pos": 3, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn3", "evidence": [ { "id": "Q56UD9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q56UD9#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [ { "id": "rno:297795", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:297795", "resource": "KEGG Pathway" }, { "id": "R-RNO-375276", "name": "Peptide ligand-binding receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-375276", "resource": "Reactome", "description": "Peptide ligand-binding receptors" }, { "id": "R-RNO-418594", "name": "G alpha (i) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-418594", "resource": "Reactome", "description": "G alpha (i) signalling events" } ], "orthologs": [ { "uniprot_canonical_ac": "P48145-1", "protein_name": "Neuropeptides B/W receptor type 1", "gene_name": "NPBWR1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDNASFSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGNSAVLYVLLRAPRMKTVTNLFILNLAIADELFTLVLPINIADFLLRQWPFGELMCKLIVAIDQYNTFSSLYFLTVMSADRYLVVLATAESRRVAGRTYSAARAVSLAVWGIVTLVVLPFAVFARLDDEQGRRQCVLVFPQPEAFWWRASRLYTLVLGFAIPVSTICVLYTTLLCRLHAMRLDSHAKALERAKKRVTFLVVAILAVCLLCWTPYHLSTVVALTTDLPQTPLVIAISYFITSLSYANSCLNPFLYAFLDASFRRNLRQLITCRAAA", "length": 328 }, "evidence": [ { "id": "Q56UD9", "url": "https://omabrowser.org/oma/group/Q56UD9/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P49681-1", "protein_name": "Neuropeptides B/W receptor type 1", "gene_name": "Npbwr1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MHNLTLFESGGDNVSCGGSSLGCPNGSSLAPLPLPQPLAVAVPVVYGVICAVGLAGNSAVLYVLLRTPRMKTVTNVFILNLAIADELFTLVLPINIADFLLRRWPFGEVMCKLIVAVDQYNTFSSLYFLAVMSADRYLVVLATAESRRVSGRTYGAARAVSLAVWALVTLVVLPFAVFARLDEEQGRRQCVLVFPQPEAFWWRASRLYTLVLGFAIPVTTICALYTTLLCRLRAIQLDSHAKALDRAKKRVTLLVAAILAVCLLCWTPYHLSTIVALTTDLPQTPLVIGISYFITSLSYANSCLNPFLYAFLDDSFRRSLRQLVSCRSA", "length": 329 }, "evidence": [ { "id": "Q56UD9", "url": "https://omabrowser.org/oma/group/Q56UD9/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "regulation of metabolic process", "id": "GO:0019222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019222", "evidence": [ { "database": "UniProtKB", "id": "Q56UD9", "url": "https://www.uniprot.org/uniprot/Q56UD9" } ], "pmid": "" }, { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "Q56UD9", "url": "https://www.uniprot.org/uniprot/Q56UD9" } ], "pmid": "" }, { "name": "neuropeptide signaling pathway", "id": "GO:0007218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007218", "evidence": [ { "database": "UniProtKB", "id": "Q56UD9", "url": "https://www.uniprot.org/uniprot/Q56UD9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "Q56UD9", "url": "https://www.uniprot.org/uniprot/Q56UD9" } ], "pmid": "" }, { "name": "neuropeptide receptor activity", "id": "GO:0008188", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008188", "evidence": [ { "database": "UniProtKB", "id": "Q56UD9", "url": "https://www.uniprot.org/uniprot/Q56UD9" } ], "pmid": "" }, { "name": "neuropeptide binding", "id": "GO:0042923", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042923", "evidence": [ { "database": "UniProtKB", "id": "Q56UD9", "url": "https://www.uniprot.org/uniprot/Q56UD9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q56UD9", "url": "https://www.uniprot.org/uniprot/Q56UD9" } ], "pmid": "" }, { "name": "neuron projection", "id": "GO:0043005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043005", "evidence": [ { "database": "UniProtKB", "id": "Q56UD9", "url": "https://www.uniprot.org/uniprot/Q56UD9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 13, "end_pos": 15, "annotation": "n_glycosylation_sequon" }, { "start_pos": 25, "end_pos": 27, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3, "end_pos": 5, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }