{ "uniprot_canonical_ac": "Q568Y3-1", "uniprot_ac": "Q568Y3", "uniprot_id": "RN185_RAT", "mass": { "chemical_mass": 20493.0, "monoisotopic_mass": 20493.0 }, "refseq": { "ac": "NP_001019442", "name": "E3 ubiquitin-protein ligase RNF185", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019442" }, "gene_names": [ { "name": "Rnf185", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q568Y3", "id": "Q568Y3" }, { "name": "Rnf185", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019442", "id": "NP_001019442" } ], "protein_names": [ { "name": "E3 ubiquitin-protein ligase RNF185", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q568Y3" }, { "name": "2.3.2.27", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q568Y3" }, { "name": "E3 ubiquitin-protein ligase RNF185", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019442", "id": "NP_001019442" }, { "name": "RING finger protein 185", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q568Y3" }, { "name": "RING-type E3 ubiquitin transferase RNF185", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019442", "id": "NP_001019442" } ], "function": [ { "annotation": "E3 ubiquitin-protein ligase that regulates selective mitochondrial autophagy by mediating 'Lys-63'-linked polyubiquitination of BNIP1. Acts in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway, which targets misfolded proteins that accumulate in the endoplasmic reticulum (ER) for ubiquitination and subsequent proteasome-mediated degradation. Protects cells from ER stress-induced apoptosis. Responsible for the cotranslational ubiquitination and degradation of CFTR in the ERAD pathway. Also acts as a regulator of the innate antiviral response by catalyzing 'Lys-27'-linked polyubiquitination of CGAS, thereby promoting CGAS cyclic GMP-AMP synthase activity. Preferentially associates with the E2 enzymes UBE2J1 and UBE2J2.", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3#function" }, { "database": "UniProtKB", "id": "Q96GF1", "url": "https://www.uniprot.org/uniprot/Q96GF1#function" } ] }, { "annotation": "E3 ubiquitin-protein ligase.", "evidence": [ { "database": "UniProtKB", "id": "A0A8I6AG35", "url": "https://www.uniprot.org/uniprot/A0A8I6AG35#function" }, { "database": "UniProtKB", "id": "RU369090", "url": "https://www.uniprot.org/uniprot/RU369090#function" }, { "database": "UniProtKB", "id": "A0A8I6ASX8", "url": "https://www.uniprot.org/uniprot/A0A8I6ASX8#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "common_name": "Rat" } ], "gene": [ { "name": "Rnf185", "url": "https://www.uniprot.org/uniprot/Q568Y3", "locus": { "chromosome": "14", "start_pos": 78292516, "end_pos": 78329864, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000019325", "url": "https://www.ensembl.org/id/ENSRNOG00000019325" } ] } } ], "crossref": [ { "id": "ENSRNOG00000019325", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000019325", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd16744", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16744", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "360967", "url": "https://www.ncbi.nlm.nih.gov/gene/360967", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001841", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001841", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017907", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017907", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045103", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045103", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:360967", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:360967", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "ALMIMFW", "url": "https://omabrowser.org/oma/group/ALMIMFW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "276791at2759", "url": "http://www.orthodb.org/?query=276791at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12313", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12313", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12313:SF13", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12313:SF13", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13920", "url": "http://pfam.xfam.org/family/PF13920", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q568Y3", "url": "http://purl.obolibrary.org/obo/PR_Q568Y3", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-382556", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-382556", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001019442", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019442", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1564777", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1564777", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I6AG35", "url": "https://www.uniprot.org/uniprot/A0A8I6AG35", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6AG35-1", "url": "https://www.uniprot.org/uniprot/A0A8I6AG35-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6ASX8", "url": "https://www.uniprot.org/uniprot/A0A8I6ASX8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6ASX8-1", "url": "https://www.uniprot.org/uniprot/A0A8I6ASX8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q568Y3-1", "url": "https://www.uniprot.org/uniprot/Q568Y3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASKGPSASASTENSSAGGPSGSSNGTGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA", "length": 192, "header": "sp|Q568Y3-1|RN185_RAT Isoform 1 of E3 ubiquitin-protein ligase RNF185 OS=Rattus norvegicus OX=10116 GN=Rnf185 PE=2 SV=1 CANONICAL=Q568Y3-1" }, "isoforms": [ { "isoform_ac": "A0A8I6AG35-1", "url": "", "sequence": { "sequence": "MTLNSLPSAGCQMCASIPFPICDASNSWEASLYSSYPLLMSLLYSWSVSANESIFLLLPAFLPDDWPPWGLCSWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA", "length": 206, "header": "tr|A0A8I6AG35-1|RN185_RAT Computationally mapped isoform of E3 ubiquitin-protein ligase RNF185 OS=Rattus norvegicus OX=10116 GN=Rnf185 PE=2 SV=1 CANONICAL=Q568Y3-1" }, "locus": { "chromosome": "14", "start_pos": 78305100, "end_pos": 78294549, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000101941.1", "url": "https://www.ensembl.org/id/ENSRNOT00000101941.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000091688.1", "url": "https://www.ensembl.org/id/ENSRNOP00000091688.1" } ] } }, { "isoform_ac": "A0A8I6ASX8-1", "url": "", "sequence": { "sequence": "MQHMSGHSQGRCHQPVWPPFLWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA", "length": 148, "header": "tr|A0A8I6ASX8-1|RN185_RAT Computationally mapped isoform of E3 ubiquitin-protein ligase RNF185 OS=Rattus norvegicus OX=10116 GN=Rnf185 PE=2 SV=1 CANONICAL=Q568Y3-1" }, "locus": { "chromosome": "14", "start_pos": 78308184, "end_pos": 78294549, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000106301.1", "url": "https://www.ensembl.org/id/ENSRNOT00000106301.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000096656.1", "url": "https://www.ensembl.org/id/ENSRNOP00000096656.1" } ] } }, { "isoform_ac": "Q568Y3-1", "url": "", "sequence": { "sequence": "MASKGPSASASTENSSAGGPSGSSNGTGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA", "length": 192, "header": "sp|Q568Y3-1|RN185_RAT Isoform 1 of E3 ubiquitin-protein ligase RNF185 OS=Rattus norvegicus OX=10116 GN=Rnf185 PE=2 SV=1 CANONICAL=Q568Y3-1" }, "locus": { "chromosome": "14", "start_pos": 78308297, "end_pos": 78294549, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000026134", "url": "https://www.ensembl.org/id/ENSRNOT00000026134" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000026134", "url": "https://www.ensembl.org/id/ENSRNOP00000026134" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "rno:360967", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:360967", "resource": "KEGG Pathway" }, { "id": "R-RNO-382556", "name": "ABC-family proteins mediated transport", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-382556", "resource": "Reactome", "description": "ABC-family proteins mediated transport" } ], "orthologs": [ { "uniprot_canonical_ac": "Q91YT2-1", "protein_name": "E3 ubiquitin-protein ligase RNF185", "gene_name": "Rnf185", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MASKGPSASASTENSNAGGPSGSSNGTGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA", "length": 192 }, "evidence": [ { "id": "45235187", "url": "http://www.informatics.jax.org/homology/45235187", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q96GF1-1", "protein_name": "E3 ubiquitin-protein ligase RNF185", "gene_name": "RNF185", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA", "length": 192 }, "evidence": [ { "id": "45235187", "url": "http://www.informatics.jax.org/homology/45235187", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "mitochondrial membrane", "id": "GO:0031966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031966", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "mitochondrial outer membrane", "id": "GO:0005741", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005741", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "ubiquitin protein ligase activity", "id": "GO:0061630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061630", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "ubiquitin-like protein conjugating enzyme binding", "id": "GO:0044390", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044390", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "ubiquitin binding", "id": "GO:0043130", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043130", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "enzyme activator activity", "id": "GO:0008047", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008047", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 13, "go_terms": [ { "name": "protein ubiquitination", "id": "GO:0016567", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "ubiquitin-dependent protein catabolic process", "id": "GO:0006511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006511", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "defense response to virus", "id": "GO:0051607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051607", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "ubiquitin-dependent ERAD pathway", "id": "GO:0030433", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030433", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "protein autoubiquitination", "id": "GO:0051865", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051865", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "positive regulation of ERAD pathway", "id": "GO:1904294", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904294", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "positive regulation of type I interferon-mediated signaling pathway", "id": "GO:0060340", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060340", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "protein K27-linked ubiquitination", "id": "GO:0044314", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044314", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "autophagy", "id": "GO:0006914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006914", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "ERAD pathway", "id": "GO:0036503", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036503", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "ER-associated misfolded protein catabolic process", "id": "GO:0071712", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071712", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" }, { "name": "positive regulation of innate immune response", "id": "GO:0045089", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045089", "evidence": [ { "database": "UniProtKB", "id": "Q568Y3", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 14, "end_pos": 16, "annotation": "n_glycosylation_sequon" }, { "start_pos": 25, "end_pos": 27, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-RNO-8866542", "name": "VCP-catalyzed ATP hydrolysis promotes the translocation of misfolded CFTR into the cytosol", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P34158-1", "P46462-1", "Q568Y3-1", "Q5M807-1" ], "evidence": [ { "id": "R-RNO-8866542", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8866542" } ] }, { "id": "R-RNO-8866546", "name": "RNF5 and RNF185 ubiquitinate misfolded CFTR", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P34158-1", "P46462-1", "Q568Y3-1", "Q5M807-1" ], "evidence": [ { "id": "R-RNO-8866546", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8866546" } ] }, { "id": "R-RNO-8866551", "name": "CFTR binds components of the ERAD machinery for ubiquitination and degradation", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P34158-1", "P46462-1", "Q568Y3-1", "Q5M807-1" ], "evidence": [ { "id": "R-RNO-8866551", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8866551" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P34158", "gene_name": "Cftr", "activity": [ { "ec_number": "5.6.1.6", "activity": "ATP + H2O + closed Cl(-) channel = ADP + phosphate + open Cl(-) channel.", "evidence": [ { "id": "P34158", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34158" } ] }, { "ec_number": "5.6.1.6", "activity": "", "evidence": [ { "id": "P34158", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34158" } ] } ] }, { "uniprot_ac": "P46462", "gene_name": "Vcp", "activity": [ { "ec_number": "3.6.4.6", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P46462", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46462" } ] }, { "ec_number": "3.6.4.6", "activity": "", "evidence": [ { "id": "P46462", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46462" } ] } ] }, { "uniprot_ac": "Q568Y3", "gene_name": "Rnf185", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q568Y3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q568Y3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q568Y3" } ] } ] }, { "uniprot_ac": "Q5M807", "gene_name": "Rnf5", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q5M807", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5M807" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q5M807", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5M807" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }