{ "uniprot_canonical_ac": "Q54XI5-1", "uniprot_ac": "Q54XI5", "uniprot_id": "RL9_DICDI", "mass": { "chemical_mass": 21219.0, "monoisotopic_mass": 21219.0 }, "refseq": { "ac": "XP_647818", "name": "60S ribosomal protein L9", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_647818" }, "gene_names": [ { "name": "rpl9", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q54XI5", "id": "Q54XI5" }, { "name": "DDB_G0278959", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q54XI5", "id": "Q54XI5" }, { "name": "rpl9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_647818", "id": "XP_647818" } ], "protein_names": [ { "name": "Large ribosomal subunit protein uL6", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q54XI5" }, { "name": "60S ribosomal protein L9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_647818", "id": "XP_647818" }, { "name": "60S ribosomal protein L9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q54XI5" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "Q54XI5", "url": "https://www.uniprot.org/uniprot/Q54XI5" } ], "common_name": "Dictyostelium discoideum" } ], "gene": [ { "name": "rpl9", "url": "https://www.uniprot.org/uniprot/Q54XI5", "locus": {} } ], "crossref": [ { "id": "DDB_G0278959", "url": "", "database": "", "categories": [ "Organism-specific" ] }, { "id": "8621778", "url": "https://www.ncbi.nlm.nih.gov/gene/8621778", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000702", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000702", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002359", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002359", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020040", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020040", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036789", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036789", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0278959", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0278959", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "YAHFPMK", "url": "https://omabrowser.org/oma/group/YAHFPMK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR11655", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11655", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11655:SF16", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11655:SF16", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5AN9", "url": "https://www.rcsb.org/structure/5AN9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ANB", "url": "https://www.rcsb.org/structure/5ANB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5ANC", "url": "https://www.rcsb.org/structure/5ANC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6QKL", "url": "https://www.rcsb.org/structure/6QKL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00347", "url": "http://pfam.xfam.org/family/PF00347", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q54XI5", "url": "http://purl.obolibrary.org/obo/PR_Q54XI5", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DDI-156827", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-156827", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-1799339", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-1799339", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-72689", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-72689", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-72706", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-72706", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-975956", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-975956", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-975957", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-975957", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_647818", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_647818", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q54XI5", "url": "https://www.uniprot.org/uniprot/Q54XI5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q54XI5-1", "url": "https://www.uniprot.org/uniprot/Q54XI5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKVINSSRKVQIPENVTVDVKGRSVKVTGPRGTLSKSFDHASVDINLVGKKELTVDLWFGNRKQIACIKTITSIIENMITGVTKGYEYKMRFVYAHFPINVAVTDGGRVVEIRNFFGEKIVRRIELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNVLESN", "length": 188, "header": "sp|Q54XI5-1|RL9_DICDI Isoform 1 of Large ribosomal subunit protein uL6 OS=Dictyostelium discoideum OX=44689 GN=rpl9 PE=1 SV=2 CANONICAL=Q54XI5-1" }, "isoforms": [ { "isoform_ac": "Q54XI5-1", "url": "", "sequence": { "sequence": "MKVINSSRKVQIPENVTVDVKGRSVKVTGPRGTLSKSFDHASVDINLVGKKELTVDLWFGNRKQIACIKTITSIIENMITGVTKGYEYKMRFVYAHFPINVAVTDGGRVVEIRNFFGEKIVRRIELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNVLESN", "length": 188, "header": "sp|Q54XI5-1|RL9_DICDI Isoform 1 of Large ribosomal subunit protein uL6 OS=Dictyostelium discoideum OX=44689 GN=rpl9 PE=1 SV=2 CANONICAL=Q54XI5-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Chen G., Gibbs R.A., Gloeckner G., Hernandez J., Johnson D., Knights A., Lehmann R., Loulseged H., Ma J., Muzny D.M., Oliver K., Platzer M., Rosenthal A., Saito T., Sodergren E., Steffen D., Sugano S., Walker D., Weinstock G., Lu M., Muzny D., Tanaka Y., Song J., Sodergren E.J., Xu Q., Bankier A.T., Barrell B.G., Williams J., Fey P., Nie X., Gibbs R., Dear P.H., Szafranski K., Davies R., Price C., James K., Noegel A.A., Glockner G., Cooper J., Morio T., Davis P., Williams J.G., Kay R.R., Cronin A., Schleicher M., Olsen R., Kummerfeld S., Sharp S., Hauser H., Weinstock G.M., White B., Quiles M., Rost R., Tunggal B., Pain A., Madan Babu M., Madera M., Rivero F., Saunders D., Eichinger L., Sanders M., Kohara Y., Chisholm R.L., Barrell B., Churcher C.M., Hamlin N., Rajandream M.A., Thangavelu M., Quail M.A., Anjard C., Cox E.C., Haydock S., Kuspa A., Loomis W.F., Shaulsky G., Sucgang R., Urushihara H., Bason N., Berriman M., Buchrieser C., Churcher C., Desany B., Farbrother P., Felder M., Gaudet P., Goodhead I., Hall N., Harper D., Hemphill L., James K.D., Just E., Kerhornou A., Konfortov B.A., Lindsay R., Mourier T., Mungall K., Mungall K.L., Pachebat J.A., Pilcher K., Rabbinowitsch E., Simmonds M., Simmonds M.N., Spiegler S., Tivey A., Wardroper A., Winckler T., Woodward J., Woodward J.R., van Driessche N.", "evidence": [ { "database": "UniProtKB", "id": "Q54XI5", "url": "https://www.uniprot.org/uniprot/Q54XI5" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] }, { "title": "Proteomics fingerprinting of phagosome maturation and evidence for the role of a Galpha during uptake.", "journal": "Mol. Cell. Proteomics", "date": "2006", "authors": "Ruppert T., Delorenzi M., Gotthardt D., Soldati T., Blancheteau V., Bosserhoff A.", "evidence": [ { "database": "UniProtKB", "id": "Q54XI5", "url": "https://www.uniprot.org/uniprot/Q54XI5" } ], "reference": [ { "type": "PubMed", "id": "16926386", "url": "https://glygen.org/publication/PubMed/16926386" } ] } ], "pathway": [ { "id": "ddi:DDB_G0278959", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0278959", "resource": "KEGG Pathway" }, { "id": "R-DDI-156827", "name": "L13a-mediated translational silencing of Ceruloplasmin expression", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-156827", "resource": "Reactome", "description": "L13a-mediated translational silencing of Ceruloplasmin expression" }, { "id": "R-DDI-1799339", "name": "SRP-dependent cotranslational protein targeting to membrane", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-1799339", "resource": "Reactome", "description": "SRP-dependent cotranslational protein targeting to membrane" }, { "id": "R-DDI-72689", "name": "Formation of a pool of free 40S subunits", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-72689", "resource": "Reactome", "description": "Formation of a pool of free 40S subunits" }, { "id": "R-DDI-72706", "name": "GTP hydrolysis and joining of the 60S ribosomal subunit", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-72706", "resource": "Reactome", "description": "GTP hydrolysis and joining of the 60S ribosomal subunit" }, { "id": "R-DDI-975956", "name": "Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-975956", "resource": "Reactome", "description": "Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)" }, { "id": "R-DDI-975957", "name": "Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-975957", "resource": "Reactome", "description": "Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular matrix", "id": "GO:0031012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012", "evidence": [ { "database": "UniProtKB", "id": "Q54XI5", "url": "https://www.uniprot.org/uniprot/Q54XI5" } ], "pmid": "" }, { "name": "phagocytic vesicle", "id": "GO:0045335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045335", "evidence": [ { "database": "UniProtKB", "id": "Q54XI5", "url": "https://www.uniprot.org/uniprot/Q54XI5" } ], "pmid": "" }, { "name": "cytosolic large ribosomal subunit", "id": "GO:0022625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022625", "evidence": [ { "database": "UniProtKB", "id": "Q54XI5", "url": "https://www.uniprot.org/uniprot/Q54XI5" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "rRNA binding", "id": "GO:0019843", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019843", "evidence": [ { "database": "UniProtKB", "id": "Q54XI5", "url": "https://www.uniprot.org/uniprot/Q54XI5" } ], "pmid": "" }, { "name": "structural constituent of ribosome", "id": "GO:0003735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003735", "evidence": [ { "database": "UniProtKB", "id": "Q54XI5", "url": "https://www.uniprot.org/uniprot/Q54XI5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "cytoplasmic translation", "id": "GO:0002181", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002181", "evidence": [ { "database": "UniProtKB", "id": "Q54XI5", "url": "https://www.uniprot.org/uniprot/Q54XI5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 15, "end_pos": 17, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }