{ "uniprot_canonical_ac": "Q54R65-1", "uniprot_ac": "Q54R65", "uniprot_id": "COF4_DICDI", "mass": { "chemical_mass": 15659.0, "monoisotopic_mass": 15659.0 }, "refseq": { "ac": "XP_639118", "name": "hypothetical protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_639118" }, "gene_names": [ { "name": "cofE", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q54R65", "id": "Q54R65" }, { "name": "DDB_G0283367", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q54R65", "id": "Q54R65" }, { "name": "cofE", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_639118", "id": "XP_639118" } ], "protein_names": [ { "name": "Cofilin-4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q54R65" }, { "name": "hypothetical protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_639118", "id": "XP_639118" } ], "function": [ { "annotation": "Controls actin polymerization and depolymerization.", "evidence": [ { "database": "UniProtKB", "id": "Q54R65", "url": "https://www.uniprot.org/uniprot/Q54R65#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "Q54R65", "url": "https://www.uniprot.org/uniprot/Q54R65" } ], "common_name": "Dictyostelium discoideum" } ], "gene": [ { "name": "cofE", "url": "https://www.uniprot.org/uniprot/Q54R65", "locus": {} } ], "crossref": [ { "id": "cd11286", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11286", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "DDB_G0283367", "url": "", "database": "", "categories": [ "Organism-specific" ] }, { "id": "8624051", "url": "https://www.ncbi.nlm.nih.gov/gene/8624051", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002108", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002108", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017904", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017904", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029006", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029006", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0283367", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0283367", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NECKYAI", "url": "https://omabrowser.org/oma/group/NECKYAI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR11913", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11913", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11913:SF12", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11913:SF12", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00241", "url": "http://pfam.xfam.org/family/PF00241", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q54R65", "url": "http://purl.obolibrary.org/obo/PR_Q54R65", "database": "PRO", "categories": [ "Protein" ] }, { "id": "XP_639118", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_639118", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q54R65", "url": "https://www.uniprot.org/uniprot/Q54R65", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q54R65-1", "url": "https://www.uniprot.org/uniprot/Q54R65-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNSCASINDEVITKYNELILGHISKGIIIKFSDDFKEVVFEDSFNGESFEDYINKFPQDDCRYGVYDFSYMDNKENKKNKIFFISWCPVETKIKNKIVHTATEQSIYKKLVGIDAIIKATDNTEISQSLVEERCK", "length": 135, "header": "sp|Q54R65-1|COF4_DICDI Isoform 1 of Cofilin-4 OS=Dictyostelium discoideum OX=44689 GN=cofE PE=3 SV=1 CANONICAL=Q54R65-1" }, "isoforms": [ { "isoform_ac": "Q54R65-1", "url": "", "sequence": { "sequence": "MNSCASINDEVITKYNELILGHISKGIIIKFSDDFKEVVFEDSFNGESFEDYINKFPQDDCRYGVYDFSYMDNKENKKNKIFFISWCPVETKIKNKIVHTATEQSIYKKLVGIDAIIKATDNTEISQSLVEERCK", "length": 135, "header": "sp|Q54R65-1|COF4_DICDI Isoform 1 of Cofilin-4 OS=Dictyostelium discoideum OX=44689 GN=cofE PE=3 SV=1 CANONICAL=Q54R65-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Chen G., Gibbs R.A., Gloeckner G., Hernandez J., Johnson D., Knights A., Lehmann R., Loulseged H., Ma J., Muzny D.M., Oliver K., Platzer M., Rosenthal A., Saito T., Sodergren E., Steffen D., Sugano S., Walker D., Weinstock G., Lu M., Muzny D., Tanaka Y., Song J., Sodergren E.J., Xu Q., Bankier A.T., Barrell B.G., Williams J., Fey P., Nie X., Gibbs R., Dear P.H., Szafranski K., Davies R., Price C., James K., Noegel A.A., Glockner G., Cooper J., Morio T., Davis P., Williams J.G., Kay R.R., Cronin A., Schleicher M., Olsen R., Kummerfeld S., Sharp S., Hauser H., Weinstock G.M., White B., Quiles M., Rost R., Tunggal B., Pain A., Madan Babu M., Madera M., Rivero F., Saunders D., Eichinger L., Sanders M., Kohara Y., Chisholm R.L., Barrell B., Churcher C.M., Hamlin N., Rajandream M.A., Thangavelu M., Quail M.A., Anjard C., Cox E.C., Haydock S., Kuspa A., Loomis W.F., Shaulsky G., Sucgang R., Urushihara H., Bason N., Berriman M., Buchrieser C., Churcher C., Desany B., Farbrother P., Felder M., Gaudet P., Goodhead I., Hall N., Harper D., Hemphill L., James K.D., Just E., Kerhornou A., Konfortov B.A., Lindsay R., Mourier T., Mungall K., Mungall K.L., Pachebat J.A., Pilcher K., Rabbinowitsch E., Simmonds M., Simmonds M.N., Spiegler S., Tivey A., Wardroper A., Winckler T., Woodward J., Woodward J.R., van Driessche N.", "evidence": [ { "database": "UniProtKB", "id": "Q54R65", "url": "https://www.uniprot.org/uniprot/Q54R65" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] } ], "pathway": [ { "id": "ddi:DDB_G0283367", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0283367", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q54R65", "url": "https://www.uniprot.org/uniprot/Q54R65" } ], "pmid": "" }, { "name": "actin cytoskeleton", "id": "GO:0015629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015629", "evidence": [ { "database": "UniProtKB", "id": "Q54R65", "url": "https://www.uniprot.org/uniprot/Q54R65" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "actin filament binding", "id": "GO:0051015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051015", "evidence": [ { "database": "UniProtKB", "id": "Q54R65", "url": "https://www.uniprot.org/uniprot/Q54R65" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "actin filament severing", "id": "GO:0051014", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051014", "evidence": [ { "database": "UniProtKB", "id": "Q54R65", "url": "https://www.uniprot.org/uniprot/Q54R65" } ], "pmid": "" }, { "name": "actin filament depolymerization", "id": "GO:0030042", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030042", "evidence": [ { "database": "UniProtKB", "id": "Q54R65", "url": "https://www.uniprot.org/uniprot/Q54R65" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }