{ "uniprot_canonical_ac": "Q54QJ9-1", "uniprot_ac": "Q54QJ9", "uniprot_id": "KAD2_DICDI", "mass": { "chemical_mass": 30985.0, "monoisotopic_mass": 30985.0 }, "refseq": { "ac": "XP_638872", "name": "adenylate kinase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_638872" }, "gene_names": [ { "name": "adkA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q54QJ9", "id": "Q54QJ9" }, { "name": "DDB_G0283805", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q54QJ9", "id": "Q54QJ9" }, { "name": "adkA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_638872", "id": "XP_638872" } ], "protein_names": [ { "name": "Adenylate kinase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q54QJ9" }, { "name": "2.7.4.3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q54QJ9" }, { "name": "ATP-AMP transphosphorylase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q54QJ9" }, { "name": "ATP:AMP phosphotransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q54QJ9" }, { "name": "Adenylate kinase A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q54QJ9" }, { "name": "Adenylate kinase cytosolic and mitochondrial", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q54QJ9" }, { "name": "Adenylate monophosphate kinase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q54QJ9" }, { "name": "adenylate kinase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_638872", "id": "XP_638872" } ], "function": [ { "annotation": "Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism. Adenylate kinase activity is critical for regulation of the phosphate utilization and the AMP de novo biosynthesis pathways.", "evidence": [ { "database": "UniProtKB", "id": "Q54QJ9", "url": "https://www.uniprot.org/uniprot/Q54QJ9#function" }, { "database": "UniProtKB", "id": "MF_03168", "url": "https://www.uniprot.org/uniprot/MF_03168#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "Q54QJ9", "url": "https://www.uniprot.org/uniprot/Q54QJ9" } ], "common_name": "Dictyostelium discoideum" } ], "gene": [ { "name": "adkA", "url": "https://www.uniprot.org/uniprot/Q54QJ9", "locus": {} } ], "crossref": [ { "id": "cd01428", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01428", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "DDB_G0283805", "url": "", "database": "", "categories": [ "Organism-specific" ] }, { "id": "8624270", "url": "https://www.ncbi.nlm.nih.gov/gene/8624270", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000850", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000850", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006259", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006259", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007862", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007862", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028587", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028587", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033690", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033690", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0283805", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0283805", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "FHNRMRV", "url": "https://omabrowser.org/oma/group/FHNRMRV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR23359", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23359", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23359:SF234", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23359:SF234", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00406", "url": "http://pfam.xfam.org/family/PF00406", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF05191", "url": "http://pfam.xfam.org/family/PF05191", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q54QJ9", "url": "http://purl.obolibrary.org/obo/PR_Q54QJ9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DDI-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-499943", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_638872", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_638872", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "12973", "url": "https://www.rhea-db.org/rhea/12973", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q54QJ9", "url": "https://www.uniprot.org/uniprot/Q54QJ9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q54QJ9-1", "url": "https://www.uniprot.org/uniprot/Q54QJ9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEPQFKVKIDNDSARILKELAEKKRDEGLRVVFIGPPGSGKGTQAPLVKEDYCLCHLSTGDMLRAAIEQGTETGKQAKTIMDQGGLVPDEVMVNMIKENIQTPECKKGFILDGFPRTVPQAEKLDKMLAEDNKKIDHVLDFAIDDSLLVKRITGRLVHPSSGRSYHREFFPPKVDMIDDITGEPLIQRSDDNEEVLKKRLESFHKNTTPVLGYYQNKGILSTIDASKSAPFVSHTIKSIFLSTLHFPHNASIFKTFHQKMKMQVHSTETPLAAEIL", "length": 276, "header": "sp|Q54QJ9-1|KAD2_DICDI Isoform 1 of Adenylate kinase OS=Dictyostelium discoideum OX=44689 GN=adkA PE=3 SV=1 CANONICAL=Q54QJ9-1" }, "isoforms": [ { "isoform_ac": "Q54QJ9-1", "url": "", "sequence": { "sequence": "MEPQFKVKIDNDSARILKELAEKKRDEGLRVVFIGPPGSGKGTQAPLVKEDYCLCHLSTGDMLRAAIEQGTETGKQAKTIMDQGGLVPDEVMVNMIKENIQTPECKKGFILDGFPRTVPQAEKLDKMLAEDNKKIDHVLDFAIDDSLLVKRITGRLVHPSSGRSYHREFFPPKVDMIDDITGEPLIQRSDDNEEVLKKRLESFHKNTTPVLGYYQNKGILSTIDASKSAPFVSHTIKSIFLSTLHFPHNASIFKTFHQKMKMQVHSTETPLAAEIL", "length": 276, "header": "sp|Q54QJ9-1|KAD2_DICDI Isoform 1 of Adenylate kinase OS=Dictyostelium discoideum OX=44689 GN=adkA PE=3 SV=1 CANONICAL=Q54QJ9-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Chen G., Gibbs R.A., Gloeckner G., Hernandez J., Johnson D., Knights A., Lehmann R., Loulseged H., Ma J., Muzny D.M., Oliver K., Platzer M., Rosenthal A., Saito T., Sodergren E., Steffen D., Sugano S., Walker D., Weinstock G., Lu M., Muzny D., Tanaka Y., Song J., Sodergren E.J., Xu Q., Bankier A.T., Barrell B.G., Williams J., Fey P., Nie X., Gibbs R., Dear P.H., Szafranski K., Davies R., Price C., James K., Noegel A.A., Glockner G., Cooper J., Morio T., Davis P., Williams J.G., Kay R.R., Cronin A., Schleicher M., Olsen R., Kummerfeld S., Sharp S., Hauser H., Weinstock G.M., White B., Quiles M., Rost R., Tunggal B., Pain A., Madan Babu M., Madera M., Rivero F., Saunders D., Eichinger L., Sanders M., Kohara Y., Chisholm R.L., Barrell B., Churcher C.M., Hamlin N., Rajandream M.A., Thangavelu M., Quail M.A., Anjard C., Cox E.C., Haydock S., Kuspa A., Loomis W.F., Shaulsky G., Sucgang R., Urushihara H., Bason N., Berriman M., Buchrieser C., Churcher C., Desany B., Farbrother P., Felder M., Gaudet P., Goodhead I., Hall N., Harper D., Hemphill L., James K.D., Just E., Kerhornou A., Konfortov B.A., Lindsay R., Mourier T., Mungall K., Mungall K.L., Pachebat J.A., Pilcher K., Rabbinowitsch E., Simmonds M., Simmonds M.N., Spiegler S., Tivey A., Wardroper A., Winckler T., Woodward J., Woodward J.R., van Driessche N.", "evidence": [ { "database": "UniProtKB", "id": "Q54QJ9", "url": "https://www.uniprot.org/uniprot/Q54QJ9" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] } ], "pathway": [ { "id": "ddi:DDB_G0283805", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0283805", "resource": "KEGG Pathway" }, { "id": "R-DDI-499943", "name": "Interconversion of nucleotide di- and triphosphates", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-499943", "resource": "Reactome", "description": "Interconversion of nucleotide di- and triphosphates" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "adenylate kinase activity", "id": "GO:0004017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004017", "evidence": [ { "database": "UniProtKB", "id": "Q54QJ9", "url": "https://www.uniprot.org/uniprot/Q54QJ9" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "Q54QJ9", "url": "https://www.uniprot.org/uniprot/Q54QJ9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "ADP biosynthetic process", "id": "GO:0006172", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006172", "evidence": [ { "database": "UniProtKB", "id": "Q54QJ9", "url": "https://www.uniprot.org/uniprot/Q54QJ9" } ], "pmid": "" }, { "name": "AMP metabolic process", "id": "GO:0046033", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046033", "evidence": [ { "database": "UniProtKB", "id": "Q54QJ9", "url": "https://www.uniprot.org/uniprot/Q54QJ9" } ], "pmid": "" }, { "name": "phosphorylation", "id": "GO:0016310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310", "evidence": [ { "database": "UniProtKB", "id": "Q54QJ9", "url": "https://www.uniprot.org/uniprot/Q54QJ9" } ], "pmid": "" }, { "name": "purine ribonucleoside salvage", "id": "GO:0006166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006166", "evidence": [ { "database": "UniProtKB", "id": "Q54QJ9", "url": "https://www.uniprot.org/uniprot/Q54QJ9" } ], "pmid": "" }, { "name": "ATP metabolic process", "id": "GO:0046034", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046034", "evidence": [ { "database": "UniProtKB", "id": "Q54QJ9", "url": "https://www.uniprot.org/uniprot/Q54QJ9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q54QJ9", "url": "https://www.uniprot.org/uniprot/Q54QJ9" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q54QJ9", "url": "https://www.uniprot.org/uniprot/Q54QJ9" } ], "pmid": "" }, { "name": "mitochondrial intermembrane space", "id": "GO:0005758", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005758", "evidence": [ { "database": "UniProtKB", "id": "Q54QJ9", "url": "https://www.uniprot.org/uniprot/Q54QJ9" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q54QJ9", "url": "https://www.uniprot.org/uniprot/Q54QJ9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 11, "end_pos": 13, "annotation": "n_glycosylation_sequon" }, { "start_pos": 206, "end_pos": 208, "annotation": "n_glycosylation_sequon" }, { "start_pos": 249, "end_pos": 251, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "12973", "name": "", "equation": "AMP + ATP = 2 ADP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q68FP8-1", "Q5EB68-1", "P29410-1", "Q5BKE0-1", "P39069-1", "A0A8I5ZQQ9-1", "P54819-1", "Q9Y6K8-1", "P00568-1", "Q96MA6-1", "Q9Y3D8-1", "Q96M32-1", "Q9WTP6-1", "Q9R0Y5-1", "Q920P5-1", "Q8VCP8-1", "Q32M07-1", "Q9D2H2-2", "P07170-1", "Q12055-1", "Q54Y03-1", "Q54CT8-1", "Q54QJ9-1", "Q9U915-1", "Q7JYV7-1" ], "evidence": [ { "id": "12973", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/12973" } ] }, { "id": "R-DDI-110144", "name": "ADP + ADP <=> AMP + ATP [AK2]", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, mitochondrial intermembrane space", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q54QJ9-1" ], "evidence": [ { "id": "R-DDI-110144", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-110144" } ] }, { "id": "R-DDI-110145", "name": "AMP + ATP <=> ADP + ADP [AK2]", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, mitochondrial intermembrane space", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q54QJ9-1" ], "evidence": [ { "id": "R-DDI-110145", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-110145" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A8I5ZQQ9", "gene_name": "RGD1562178", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "A0A8I5ZQQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZQQ9" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "A0A8I5ZQQ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I5ZQQ9" } ] } ] }, { "uniprot_ac": "P00568", "gene_name": "AK1", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "P00568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00568" } ] } ] }, { "uniprot_ac": "P07170", "gene_name": "ADK1", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "P07170", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07170" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "P07170", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07170" } ] } ] }, { "uniprot_ac": "P29410", "gene_name": "Ak2", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "P29410", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29410" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "P29410", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29410" } ] } ] }, { "uniprot_ac": "P39069", "gene_name": "Ak1", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "P39069", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39069" } ] } ] }, { "uniprot_ac": "P54819", "gene_name": "AK2", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "P54819", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54819" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "P54819", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54819" } ] }, { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "P54819", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54819" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "P54819", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54819" } ] } ] }, { "uniprot_ac": "Q12055", "gene_name": "FAP7", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q12055", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12055" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q12055", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12055" } ] } ] }, { "uniprot_ac": "Q32M07", "gene_name": "Ak8", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q32M07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32M07" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q32M07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32M07" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q32M07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32M07" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q32M07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32M07" } ] } ] }, { "uniprot_ac": "Q54CT8", "gene_name": "adkB", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q54CT8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54CT8" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q54CT8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54CT8" } ] } ] }, { "uniprot_ac": "Q54QJ9", "gene_name": "adkA", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q54QJ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QJ9" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q54QJ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54QJ9" } ] } ] }, { "uniprot_ac": "Q54Y03", "gene_name": "", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q54Y03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y03" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q54Y03", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54Y03" } ] } ] }, { "uniprot_ac": "Q5BKE0", "gene_name": "Taf9", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q5BKE0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BKE0" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q5BKE0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BKE0" } ] } ] }, { "uniprot_ac": "Q5EB68", "gene_name": "Ak6", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q5EB68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5EB68" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q5EB68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5EB68" } ] } ] }, { "uniprot_ac": "Q68FP8", "gene_name": "Ak8", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q68FP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68FP8" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q68FP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68FP8" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q68FP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68FP8" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q68FP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68FP8" } ] } ] }, { "uniprot_ac": "Q7JYV7", "gene_name": "Ak6", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q7JYV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JYV7" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q7JYV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JYV7" } ] } ] }, { "uniprot_ac": "Q8VCP8", "gene_name": "Ak6", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q8VCP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCP8" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q8VCP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCP8" } ] } ] }, { "uniprot_ac": "Q920P5", "gene_name": "Ak5", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q920P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920P5" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q920P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920P5" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q920P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920P5" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q920P5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920P5" } ] } ] }, { "uniprot_ac": "Q96M32", "gene_name": "AK7", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q96M32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96M32" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q96M32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96M32" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q96M32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96M32" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q96M32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96M32" } ] } ] }, { "uniprot_ac": "Q96MA6", "gene_name": "AK8", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q96MA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96MA6" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q96MA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96MA6" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q96MA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96MA6" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q96MA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96MA6" } ] } ] }, { "uniprot_ac": "Q9D2H2", "gene_name": "Ak7", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q9D2H2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2H2" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9D2H2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2H2" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q9D2H2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2H2" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9D2H2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D2H2" } ] } ] }, { "uniprot_ac": "Q9R0Y5", "gene_name": "Ak1", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.10", "activity": "a ribonucleoside 5'-triphosphate + AMP = a ribonucleoside 5'-diphosphate + ADP.", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.10", "activity": "", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q9R0Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0Y5" } ] } ] }, { "uniprot_ac": "Q9U915", "gene_name": "Adk2", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q9U915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9U915" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q9U915", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9U915" } ] } ] }, { "uniprot_ac": "Q9WTP6", "gene_name": "Ak2", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q9WTP6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTP6" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q9WTP6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTP6" } ] } ] }, { "uniprot_ac": "Q9Y3D8", "gene_name": "AK6", "activity": [ { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q9Y3D8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3D8" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q9Y3D8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3D8" } ] } ] }, { "uniprot_ac": "Q9Y6K8", "gene_name": "AK5", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q9Y6K8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K8" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q9Y6K8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K8" } ] }, { "ec_number": "2.7.4.3", "activity": "AMP + ATP = 2 ADP.", "evidence": [ { "id": "Q9Y6K8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K8" } ] }, { "ec_number": "2.7.4.3", "activity": "", "evidence": [ { "id": "Q9Y6K8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6K8" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }