{ "uniprot_canonical_ac": "Q54IT3-1", "uniprot_ac": "Q54IT3", "uniprot_id": "AOFA_DICDI", "mass": { "chemical_mass": 51259.0, "monoisotopic_mass": 51259.0 }, "refseq": { "ac": "XP_636677", "name": "amine oxidase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_636677" }, "gene_names": [ { "name": "maoA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q54IT3", "id": "Q54IT3" }, { "name": "DDB_G0288541", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q54IT3", "id": "Q54IT3" }, { "name": "maoA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_636677", "id": "XP_636677" } ], "protein_names": [ { "name": "Probable flavin-containing monoamine oxidase A", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q54IT3" }, { "name": "1.4.3.4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q54IT3" }, { "name": "amine oxidase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_636677", "id": "XP_636677" }, { "name": "monoamine oxidase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_636677", "id": "XP_636677" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "Q54IT3", "url": "https://www.uniprot.org/uniprot/Q54IT3" } ], "common_name": "Dictyostelium discoideum" } ], "gene": [ { "name": "maoA", "url": "https://www.uniprot.org/uniprot/Q54IT3", "locus": {} } ], "crossref": [ { "id": "DDB_G0288541", "url": "", "database": "", "categories": [ "Organism-specific" ] }, { "id": "8626677", "url": "https://www.ncbi.nlm.nih.gov/gene/8626677", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001613", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001613", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002937", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002937", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036188", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036188", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0288541", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0288541", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PIHWAGT", "url": "https://omabrowser.org/oma/group/PIHWAGT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR43563", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43563", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43563:SF12", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43563:SF12", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01593", "url": "http://pfam.xfam.org/family/PF01593", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q54IT3", "url": "http://purl.obolibrary.org/obo/PR_Q54IT3", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DDI-141333", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-141333", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-181430", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-181430", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-379397", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-379397", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-379398", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-379398", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-379401", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-379401", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-380612", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-380612", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_636677", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_636677", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "26414", "url": "https://www.rhea-db.org/rhea/26414", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q54IT3", "url": "https://www.uniprot.org/uniprot/Q54IT3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q54IT3-1", "url": "https://www.uniprot.org/uniprot/Q54IT3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSTLYDVVIVGGGLTGLNAAYQFKKAGLNVMVLKPKDRFGGRTESIKVEDYWFDLGGQWMGGTHKYLKELCDELGVKSFPQYDEGKHVLEINGKKVYYQGNISNLNKSYNLEGLFESISKIDELSAELNPDKPYAHSKSKEYDQLTVAQWVEKNVKGNDARSIIDWFCRVCVAAEPTEVSFLFFLHFIRTAGNYGLLADIHGGAQQDRLIGGSQQISEGLAKKIGEKHYTLNAPVRSIIQDANQCTIKTDNGSTYRSKYIVVAIPPTLAGRIHYSPSMPPRRDELTQRMPMGSVIKTITIYDEPFWRKEGYSAEAISDKGPIFICYDDSSHDDKKTAIVGFIAASAAKDWAEKSPEERKRAVLDCYARWWGPKALSPRIFLEKSWKEEEYSRGCYLGYTSPGTLYQCGEHLRAPVGRIHWAGTETASVWIGYMEGALESGFRVSKEIKDKLLNSKL", "length": 456, "header": "sp|Q54IT3-1|AOFA_DICDI Isoform 1 of Probable flavin-containing monoamine oxidase A OS=Dictyostelium discoideum OX=44689 GN=maoA PE=3 SV=1 CANONICAL=Q54IT3-1" }, "isoforms": [ { "isoform_ac": "Q54IT3-1", "url": "", "sequence": { "sequence": "MSTLYDVVIVGGGLTGLNAAYQFKKAGLNVMVLKPKDRFGGRTESIKVEDYWFDLGGQWMGGTHKYLKELCDELGVKSFPQYDEGKHVLEINGKKVYYQGNISNLNKSYNLEGLFESISKIDELSAELNPDKPYAHSKSKEYDQLTVAQWVEKNVKGNDARSIIDWFCRVCVAAEPTEVSFLFFLHFIRTAGNYGLLADIHGGAQQDRLIGGSQQISEGLAKKIGEKHYTLNAPVRSIIQDANQCTIKTDNGSTYRSKYIVVAIPPTLAGRIHYSPSMPPRRDELTQRMPMGSVIKTITIYDEPFWRKEGYSAEAISDKGPIFICYDDSSHDDKKTAIVGFIAASAAKDWAEKSPEERKRAVLDCYARWWGPKALSPRIFLEKSWKEEEYSRGCYLGYTSPGTLYQCGEHLRAPVGRIHWAGTETASVWIGYMEGALESGFRVSKEIKDKLLNSKL", "length": 456, "header": "sp|Q54IT3-1|AOFA_DICDI Isoform 1 of Probable flavin-containing monoamine oxidase A OS=Dictyostelium discoideum OX=44689 GN=maoA PE=3 SV=1 CANONICAL=Q54IT3-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Chen G., Gibbs R.A., Gloeckner G., Hernandez J., Johnson D., Knights A., Lehmann R., Loulseged H., Ma J., Muzny D.M., Oliver K., Platzer M., Rosenthal A., Saito T., Sodergren E., Steffen D., Sugano S., Walker D., Weinstock G., Lu M., Muzny D., Tanaka Y., Song J., Sodergren E.J., Xu Q., Bankier A.T., Barrell B.G., Williams J., Fey P., Nie X., Gibbs R., Dear P.H., Szafranski K., Davies R., Price C., James K., Noegel A.A., Glockner G., Cooper J., Morio T., Davis P., Williams J.G., Kay R.R., Cronin A., Schleicher M., Olsen R., Kummerfeld S., Sharp S., Hauser H., Weinstock G.M., White B., Quiles M., Rost R., Tunggal B., Pain A., Madan Babu M., Madera M., Rivero F., Saunders D., Eichinger L., Sanders M., Kohara Y., Chisholm R.L., Barrell B., Churcher C.M., Hamlin N., Rajandream M.A., Thangavelu M., Quail M.A., Anjard C., Cox E.C., Haydock S., Kuspa A., Loomis W.F., Shaulsky G., Sucgang R., Urushihara H., Bason N., Berriman M., Buchrieser C., Churcher C., Desany B., Farbrother P., Felder M., Gaudet P., Goodhead I., Hall N., Harper D., Hemphill L., James K.D., Just E., Kerhornou A., Konfortov B.A., Lindsay R., Mourier T., Mungall K., Mungall K.L., Pachebat J.A., Pilcher K., Rabbinowitsch E., Simmonds M., Simmonds M.N., Spiegler S., Tivey A., Wardroper A., Winckler T., Woodward J., Woodward J.R., van Driessche N.", "evidence": [ { "database": "UniProtKB", "id": "Q54IT3", "url": "https://www.uniprot.org/uniprot/Q54IT3" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] } ], "pathway": [ { "id": "ddi:DDB_G0288541", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0288541", "resource": "KEGG Pathway" }, { "id": "R-DDI-141333", "name": "Biogenic amines are oxidatively deaminated to aldehydes by MAOA and MAOB", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-141333", "resource": "Reactome", "description": "Biogenic amines are oxidatively deaminated to aldehydes by MAOA and MAOB" }, { "id": "R-DDI-181430", "name": "Norepinephrine Neurotransmitter Release Cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-181430", "resource": "Reactome", "description": "Norepinephrine Neurotransmitter Release Cycle" }, { "id": "R-DDI-379397", "name": "Enzymatic degradation of dopamine by COMT", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-379397", "resource": "Reactome", "description": "Enzymatic degradation of dopamine by COMT" }, { "id": "R-DDI-379398", "name": "Enzymatic degradation of Dopamine by monoamine oxidase", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-379398", "resource": "Reactome", "description": "Enzymatic degradation of Dopamine by monoamine oxidase" }, { "id": "R-DDI-379401", "name": "Dopamine clearance from the synaptic cleft", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-379401", "resource": "Reactome", "description": "Dopamine clearance from the synaptic cleft" }, { "id": "R-DDI-380612", "name": "Metabolism of serotonin", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-380612", "resource": "Reactome", "description": "Metabolism of serotonin" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "monoamine oxidase activity", "id": "GO:0097621", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097621", "evidence": [ { "database": "UniProtKB", "id": "Q54IT3", "url": "https://www.uniprot.org/uniprot/Q54IT3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 101, "end_pos": 103, "annotation": "n_glycosylation_sequon" }, { "start_pos": 106, "end_pos": 108, "annotation": "n_glycosylation_sequon" }, { "start_pos": 251, "end_pos": 253, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "26414", "name": "", "equation": "a secondary aliphatic amine + H2O + O2 = a primary amine + an aldehyde + H2O2", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P19643-1", "P21396-1", "P27338-1", "P21397-1", "Q64133-1", "Q8BW75-1", "Q54IT3-1", "Q556K3-1", "Q556K4-1" ], "evidence": [ { "id": "26414", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/26414" } ] }, { "id": "R-DDI-141186", "name": "MAOA:FAD oxidatively deaminates of 5HT", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, mitochondrial outer membrane", "input_participant_list": [ "R-ALL-209914" ], "output_participant_list": [ "R-ALL-500604" ], "enzyme_list": [ "Q54IT3-1", "Q54RP5-1", "Q556K3-1", "Q556K4-1" ], "evidence": [ { "id": "R-DDI-141186", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-141186" } ] }, { "id": "R-DDI-374909", "name": "Catabolism of Noradrenaline", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, mitochondrial outer membrane", "input_participant_list": [ "R-ALL-209789" ], "output_participant_list": [ "R-ALL-5279533" ], "enzyme_list": [ "Q54IT3-1", "Q54RP5-1", "Q556K3-1", "Q556K4-1" ], "evidence": [ { "id": "R-DDI-374909", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-374909" } ] }, { "id": "R-DDI-379382", "name": "MAOA:FAD deaminates DA to DOPAC", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-159362" ], "output_participant_list": [ "R-ALL-29382", "R-ALL-29408", "R-ALL-9677997" ], "enzyme_list": [ "Q54IT3-1", "Q54RP5-1", "Q556K3-1", "Q556K4-1" ], "evidence": [ { "id": "R-DDI-379382", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-379382" } ] }, { "id": "R-DDI-379395", "name": "MAOA:FAD deaminates 3MT to HVA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, mitochondrial outer membrane", "input_participant_list": [ "R-ALL-8954997" ], "output_participant_list": [ "R-ALL-9677992" ], "enzyme_list": [ "Q54IT3-1", "Q54RP5-1", "Q556K3-1", "Q556K4-1" ], "evidence": [ { "id": "R-DDI-379395", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-379395" } ] }, { "id": "R-DDI-9677917", "name": "MAOA inhibitors bind MAOA:FAD", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, mitochondrial outer membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q54IT3-1", "Q54RP5-1", "Q556K3-1", "Q556K4-1" ], "evidence": [ { "id": "R-DDI-9677917", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9677917" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-159362", "participant_name": "DA [cytosol]", "crossref": [ { "id": "000000033882", "database": "ZINC", "url": "" }, { "id": "C03758", "database": "COMPOUND", "url": "" }, { "id": "59905", "database": "ChEBI", "url": "" }, { "id": "59905", "database": "ChEBI", "url": "" }, { "id": "C03758", "database": "COMPOUND", "url": "" }, { "id": "000000033882", "database": "ZINC", "url": "" }, { "id": "59905", "database": "ChEBI", "url": "" }, { "id": "000000033882", "database": "ZINC", "url": "" }, { "id": "C03758", "database": "COMPOUND", "url": "" }, { "id": "000000033882", "database": "ZINC", "url": "" }, { "id": "C03758", "database": "COMPOUND", "url": "" }, { "id": "59905", "database": "ChEBI", "url": "" }, { "id": "C03758", "database": "COMPOUND", "url": "" }, { "id": "59905", "database": "ChEBI", "url": "" }, { "id": "000000033882", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-209789", "participant_name": "NAd [cytosol]", "crossref": [ { "id": "C00547", "database": "COMPOUND", "url": "" }, { "id": "72587", "database": "ChEBI", "url": "" }, { "id": "000000057624", "database": "ZINC", "url": "" }, { "id": "72587", "database": "ChEBI", "url": "" }, { "id": "C00547", "database": "COMPOUND", "url": "" }, { "id": "000000057624", "database": "ZINC", "url": "" }, { "id": "C00547", "database": "COMPOUND", "url": "" }, { "id": "000000057624", "database": "ZINC", "url": "" }, { "id": "72587", "database": "ChEBI", "url": "" }, { "id": "72587", "database": "ChEBI", "url": "" }, { "id": "C00547", "database": "COMPOUND", "url": "" }, { "id": "000000057624", "database": "ZINC", "url": "" }, { "id": "C00547", "database": "COMPOUND", "url": "" }, { "id": "72587", "database": "ChEBI", "url": "" }, { "id": "000000057624", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-209914", "participant_name": "5HT [cytosol]", "crossref": [ { "id": "C00780", "database": "COMPOUND", "url": "" }, { "id": "350546", "database": "ChEBI", "url": "" }, { "id": "000000057058", "database": "ZINC", "url": "" }, { "id": "350546", "database": "ChEBI", "url": "" }, { "id": "C00780", "database": "COMPOUND", "url": "" }, { "id": "000000057058", "database": "ZINC", "url": "" }, { "id": "000000057058", "database": "ZINC", "url": "" }, { "id": "C00780", "database": "COMPOUND", "url": "" }, { "id": "350546", "database": "ChEBI", "url": "" }, { "id": "C00780", "database": "COMPOUND", "url": "" }, { "id": "350546", "database": "ChEBI", "url": "" }, { "id": "000000057058", "database": "ZINC", "url": "" }, { "id": "000000057058", "database": "ZINC", "url": "" }, { "id": "C00780", "database": "COMPOUND", "url": "" }, { "id": "350546", "database": "ChEBI", "url": "" }, { "id": "C00780", "database": "COMPOUND", "url": "" }, { "id": "350546", "database": "ChEBI", "url": "" }, { "id": "000000057058", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-29382", "participant_name": "NH3 [cytosol]", "crossref": [ { "id": "C00014", "database": "COMPOUND", "url": "" }, { "id": "16134", "database": "ChEBI", "url": "" }, { "id": "8145696", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0000051", "database": "HMDB Metabolite", "url": "" }, { "id": "HMDB0033934", "database": "HMDB Metabolite", "url": "" }, { "id": "C00014", "database": "COMPOUND", "url": "" }, { "id": "16134", "database": "ChEBI", "url": "" }, { "id": "8145696", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0000051", "database": "HMDB Metabolite", "url": "" }, { "id": "HMDB0033934", "database": "HMDB Metabolite", "url": "" }, { "id": "C00014", "database": "COMPOUND", "url": "" }, { "id": "16134", "database": "ChEBI", "url": "" }, { "id": "8145696", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0000051", "database": "HMDB Metabolite", "url": "" }, { "id": "HMDB0033934", "database": "HMDB Metabolite", "url": "" }, { "id": "C00014", "database": "COMPOUND", "url": "" }, { "id": "16134", "database": "ChEBI", "url": "" }, { "id": "8145696", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0000051", "database": "HMDB Metabolite", "url": "" }, { "id": "HMDB0033934", "database": "HMDB Metabolite", "url": "" }, { "id": "8145696", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0033934", "database": "HMDB Metabolite", "url": "" }, { "id": "C00014", "database": "COMPOUND", "url": "" }, { "id": "16134", "database": "ChEBI", "url": "" }, { "id": "HMDB0000051", "database": "HMDB Metabolite", "url": "" }, { "id": "C00014", "database": "COMPOUND", "url": "" }, { "id": "16134", "database": "ChEBI", "url": "" }, { "id": "8145696", "database": "PubChem Substance", "url": "" }, { "id": "HMDB0000051", "database": "HMDB Metabolite", "url": "" }, { "id": "HMDB0033934", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-29408", "participant_name": "H2O2 [cytosol]", "crossref": [ { "id": "C00027", "database": "COMPOUND", "url": "" }, { "id": "16240", "database": "ChEBI", "url": "" }, { "id": "HMDB0003125", "database": "HMDB Metabolite", "url": "" }, { "id": "11533079", "database": "PubChem Substance", "url": "" }, { "id": "C00027", "database": "COMPOUND", "url": "" }, { "id": "16240", "database": "ChEBI", "url": "" }, { "id": "HMDB0003125", "database": "HMDB Metabolite", "url": "" }, { "id": "11533079", "database": "PubChem Substance", "url": "" }, { "id": "C00027", "database": "COMPOUND", "url": "" }, { "id": "16240", "database": "ChEBI", "url": "" }, { "id": "HMDB0003125", "database": "HMDB Metabolite", "url": "" }, { "id": "11533079", "database": "PubChem Substance", "url": "" }, { "id": "C00027", "database": "COMPOUND", "url": "" }, { "id": "16240", "database": "ChEBI", "url": "" }, { "id": "HMDB0003125", "database": "HMDB Metabolite", "url": "" }, { "id": "11533079", "database": "PubChem Substance", "url": "" }, { "id": "C00027", "database": "COMPOUND", "url": "" }, { "id": "16240", "database": "ChEBI", "url": "" }, { "id": "HMDB0003125", "database": "HMDB Metabolite", "url": "" }, { "id": "11533079", "database": "PubChem Substance", "url": "" }, { "id": "C00027", "database": "COMPOUND", "url": "" }, { "id": "16240", "database": "ChEBI", "url": "" }, { "id": "HMDB0003125", "database": "HMDB Metabolite", "url": "" }, { "id": "11533079", "database": "PubChem Substance", "url": "" } ] }, { "participant_id": "R-ALL-500604", "participant_name": "5HIALD [cytosol]", "crossref": [ { "id": "C05634", "database": "COMPOUND", "url": "" }, { "id": "50157", "database": "ChEBI", "url": "" }, { "id": "HMDB0004073", "database": "HMDB Metabolite", "url": "" }, { "id": "8148226", "database": "PubChem Substance", "url": "" }, { "id": "000000895828", "database": "ZINC", "url": "" }, { "id": "C05634", "database": "COMPOUND", "url": "" }, { "id": "50157", "database": "ChEBI", "url": "" }, { "id": "HMDB0004073", "database": "HMDB Metabolite", "url": "" }, { "id": "8148226", "database": "PubChem Substance", "url": "" }, { "id": "000000895828", "database": "ZINC", "url": "" }, { "id": "C05634", "database": "COMPOUND", "url": "" }, { "id": "50157", "database": "ChEBI", "url": "" }, { "id": "HMDB0004073", "database": "HMDB Metabolite", "url": "" }, { "id": "8148226", "database": "PubChem Substance", "url": "" }, { "id": "000000895828", "database": "ZINC", "url": "" }, { "id": "C05634", "database": "COMPOUND", "url": "" }, { "id": "50157", "database": "ChEBI", "url": "" }, { "id": "HMDB0004073", "database": "HMDB Metabolite", "url": "" }, { "id": "8148226", "database": "PubChem Substance", "url": "" }, { "id": "000000895828", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-5279533", "participant_name": "3,4-dihydroxyphenylglycolaldehyde [cytoplasm]", "crossref": [ { "id": "27852", "database": "ChEBI", "url": "" }, { "id": "DIHYDROXYPHENYLGLYCOLALDEHYDE", "database": "AraCyc", "url": "" }, { "id": "C05577", "database": "KEGG Gene", "url": "" }, { "id": "151725", "database": "PubChem Compound", "url": "" }, { "id": "HMDB0006242", "database": "HMDB Metabolite", "url": "" }, { "id": "000000895795", "database": "ZINC", "url": "" }, { "id": "000000895798", "database": "ZINC", "url": "" }, { "id": "C05577", "database": "COMPOUND", "url": "" }, { "id": "27852", "database": "ChEBI", "url": "" }, { "id": "DIHYDROXYPHENYLGLYCOLALDEHYDE", "database": "AraCyc", "url": "" }, { "id": "C05577", "database": "KEGG Gene", "url": "" }, { "id": "151725", "database": "PubChem Compound", "url": "" }, { "id": "HMDB0006242", "database": "HMDB Metabolite", "url": "" }, { "id": "000000895795", "database": "ZINC", "url": "" }, { "id": "000000895798", "database": "ZINC", "url": "" }, { "id": "C05577", "database": "COMPOUND", "url": "" }, { "id": "27852", "database": "ChEBI", "url": "" }, { "id": "DIHYDROXYPHENYLGLYCOLALDEHYDE", "database": "AraCyc", "url": "" }, { "id": "C05577", "database": "KEGG Gene", "url": "" }, { "id": "151725", "database": "PubChem Compound", "url": "" }, { "id": "HMDB0006242", "database": "HMDB Metabolite", "url": "" }, { "id": "000000895795", "database": "ZINC", "url": "" }, { "id": "000000895798", "database": "ZINC", "url": "" }, { "id": "C05577", "database": "COMPOUND", "url": "" }, { "id": "27852", "database": "ChEBI", "url": "" }, { "id": "DIHYDROXYPHENYLGLYCOLALDEHYDE", "database": "AraCyc", "url": "" }, { "id": "C05577", "database": "KEGG Gene", "url": "" }, { "id": "151725", "database": "PubChem Compound", "url": "" }, { "id": "HMDB0006242", "database": "HMDB Metabolite", "url": "" }, { "id": "000000895795", "database": "ZINC", "url": "" }, { "id": "000000895798", "database": "ZINC", "url": "" }, { "id": "C05577", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-8954997", "participant_name": "3MT [cytosol]", "crossref": [ { "id": "1582", "database": "ChEBI", "url": "" }, { "id": "1582", "database": "ChEBI", "url": "" }, { "id": "1582", "database": "ChEBI", "url": "" }, { "id": "1582", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-9677992", "participant_name": "HVA [cytosol]", "crossref": [ { "id": "545959", "database": "ChEBI", "url": "" }, { "id": "C05582", "database": "COMPOUND", "url": "" }, { "id": "000000388262", "database": "ZINC", "url": "" }, { "id": "HMDB0000118", "database": "HMDB Metabolite", "url": "" }, { "id": "545959", "database": "ChEBI", "url": "" }, { "id": "C05582", "database": "COMPOUND", "url": "" }, { "id": "000000388262", "database": "ZINC", "url": "" }, { "id": "HMDB0000118", "database": "HMDB Metabolite", "url": "" }, { "id": "545959", "database": "ChEBI", "url": "" }, { "id": "C05582", "database": "COMPOUND", "url": "" }, { "id": "000000388262", "database": "ZINC", "url": "" }, { "id": "HMDB0000118", "database": "HMDB Metabolite", "url": "" }, { "id": "545959", "database": "ChEBI", "url": "" }, { "id": "C05582", "database": "COMPOUND", "url": "" }, { "id": "000000388262", "database": "ZINC", "url": "" }, { "id": "HMDB0000118", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-9677997", "participant_name": "DOPAC [cytosol]", "crossref": [ { "id": "17612", "database": "ChEBI", "url": "" }, { "id": "000000388555", "database": "ZINC", "url": "" }, { "id": "CPD-782", "database": "AraCyc", "url": "" }, { "id": "102-32-9", "database": "CAS", "url": "" }, { "id": "C01161", "database": "KEGG Gene", "url": "" }, { "id": "5460350", "database": "PubChem Compound", "url": "" }, { "id": "17612", "database": "ChEBI", "url": "" }, { "id": "000000388555", "database": "ZINC", "url": "" }, { "id": "CPD-782", "database": "AraCyc", "url": "" }, { "id": "102-32-9", "database": "CAS", "url": "" }, { "id": "C01161", "database": "KEGG Gene", "url": "" }, { "id": "5460350", "database": "PubChem Compound", "url": "" }, { "id": "17612", "database": "ChEBI", "url": "" }, { "id": "000000388555", "database": "ZINC", "url": "" }, { "id": "CPD-782", "database": "AraCyc", "url": "" }, { "id": "102-32-9", "database": "CAS", "url": "" }, { "id": "C01161", "database": "KEGG Gene", "url": "" }, { "id": "5460350", "database": "PubChem Compound", "url": "" }, { "id": "17612", "database": "ChEBI", "url": "" }, { "id": "000000388555", "database": "ZINC", "url": "" }, { "id": "CPD-782", "database": "AraCyc", "url": "" }, { "id": "102-32-9", "database": "CAS", "url": "" }, { "id": "C01161", "database": "KEGG Gene", "url": "" }, { "id": "5460350", "database": "PubChem Compound", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P19643", "gene_name": "Maob", "activity": [ { "ec_number": "1.4.3.-", "activity": "", "evidence": [ { "id": "P19643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19643" } ] }, { "ec_number": "1.4.3.4", "activity": "a secondary aliphatic amine + H2O + O2 = a primary amine + an aldehyde + H2O2.", "evidence": [ { "id": "P19643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19643" } ] }, { "ec_number": "1.4.3.21", "activity": "3-nitrotyramine + H2O + O2 = 4-hydroxy-3-nitrophenylacetaldehyde + H2O2 + NH4(+).", "evidence": [ { "id": "P19643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19643" } ] }, { "ec_number": "1.4.3.21", "activity": "", "evidence": [ { "id": "P19643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19643" } ] }, { "ec_number": "1.4.3.4", "activity": "", "evidence": [ { "id": "P19643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19643" } ] } ] }, { "uniprot_ac": "P21396", "gene_name": "Maoa", "activity": [ { "ec_number": "1.4.3.-", "activity": "", "evidence": [ { "id": "P21396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21396" } ] }, { "ec_number": "1.4.3.4", "activity": "a secondary aliphatic amine + H2O + O2 = a primary amine + an aldehyde + H2O2.", "evidence": [ { "id": "P21396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21396" } ] }, { "ec_number": "1.4.3.21", "activity": "3-nitrotyramine + H2O + O2 = 4-hydroxy-3-nitrophenylacetaldehyde + H2O2 + NH4(+).", "evidence": [ { "id": "P21396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21396" } ] }, { "ec_number": "1.4.3.4", "activity": "", "evidence": [ { "id": "P21396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21396" } ] }, { "ec_number": "1.4.3.21", "activity": "", "evidence": [ { "id": "P21396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21396" } ] } ] }, { "uniprot_ac": "P21397", "gene_name": "MAOA", "activity": [ { "ec_number": "1.4.3.-", "activity": "", "evidence": [ { "id": "P21397", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21397" } ] }, { "ec_number": "1.4.3.4", "activity": "a secondary aliphatic amine + H2O + O2 = a primary amine + an aldehyde + H2O2.", "evidence": [ { "id": "P21397", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21397" } ] }, { "ec_number": "1.4.3.21", "activity": "3-nitrotyramine + H2O + O2 = 4-hydroxy-3-nitrophenylacetaldehyde + H2O2 + NH4(+).", "evidence": [ { "id": "P21397", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21397" } ] }, { "ec_number": "1.4.3.21", "activity": "", "evidence": [ { "id": "P21397", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21397" } ] }, { "ec_number": "1.4.3.4", "activity": "", "evidence": [ { "id": "P21397", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21397" } ] } ] }, { "uniprot_ac": "P27338", "gene_name": "MAOB", "activity": [ { "ec_number": "1.4.3.4", "activity": "a secondary aliphatic amine + H2O + O2 = a primary amine + an aldehyde + H2O2.", "evidence": [ { "id": "P27338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27338" } ] }, { "ec_number": "1.4.3.21", "activity": "3-nitrotyramine + H2O + O2 = 4-hydroxy-3-nitrophenylacetaldehyde + H2O2 + NH4(+).", "evidence": [ { "id": "P27338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27338" } ] }, { "ec_number": "1.4.3.21", "activity": "", "evidence": [ { "id": "P27338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27338" } ] }, { "ec_number": "1.4.3.4", "activity": "", "evidence": [ { "id": "P27338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27338" } ] } ] }, { "uniprot_ac": "Q54IT3", "gene_name": "maoA", "activity": [ { "ec_number": "1.4.3.4", "activity": "a secondary aliphatic amine + H2O + O2 = a primary amine + an aldehyde + H2O2.", "evidence": [ { "id": "Q54IT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54IT3" } ] }, { "ec_number": "1.4.3.4", "activity": "", "evidence": [ { "id": "Q54IT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54IT3" } ] } ] }, { "uniprot_ac": "Q54RP5", "gene_name": "maoD", "activity": [ { "ec_number": "1.4.3.-", "activity": "", "evidence": [ { "id": "Q54RP5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RP5" } ] } ] }, { "uniprot_ac": "Q556K3", "gene_name": "maoB-1", "activity": [ { "ec_number": "1.4.3.4", "activity": "a secondary aliphatic amine + H2O + O2 = a primary amine + an aldehyde + H2O2.", "evidence": [ { "id": "Q556K3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556K3" } ] }, { "ec_number": "1.4.3.4", "activity": "", "evidence": [ { "id": "Q556K3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556K3" } ] } ] }, { "uniprot_ac": "Q556K4", "gene_name": "maoC-1", "activity": [ { "ec_number": "1.4.3.4", "activity": "a secondary aliphatic amine + H2O + O2 = a primary amine + an aldehyde + H2O2.", "evidence": [ { "id": "Q556K4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556K4" } ] }, { "ec_number": "1.4.3.4", "activity": "", "evidence": [ { "id": "Q556K4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q556K4" } ] } ] }, { "uniprot_ac": "Q64133", "gene_name": "Maoa", "activity": [ { "ec_number": "1.4.3.4", "activity": "a secondary aliphatic amine + H2O + O2 = a primary amine + an aldehyde + H2O2.", "evidence": [ { "id": "Q64133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64133" } ] }, { "ec_number": "1.4.3.21", "activity": "3-nitrotyramine + H2O + O2 = 4-hydroxy-3-nitrophenylacetaldehyde + H2O2 + NH4(+).", "evidence": [ { "id": "Q64133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64133" } ] }, { "ec_number": "1.4.3.21", "activity": "", "evidence": [ { "id": "Q64133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64133" } ] }, { "ec_number": "1.4.3.4", "activity": "", "evidence": [ { "id": "Q64133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64133" } ] } ] }, { "uniprot_ac": "Q8BW75", "gene_name": "Maob", "activity": [ { "ec_number": "1.4.3.-", "activity": "", "evidence": [ { "id": "Q8BW75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BW75" } ] }, { "ec_number": "1.4.3.4", "activity": "a secondary aliphatic amine + H2O + O2 = a primary amine + an aldehyde + H2O2.", "evidence": [ { "id": "Q8BW75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BW75" } ] }, { "ec_number": "1.4.3.21", "activity": "3-nitrotyramine + H2O + O2 = 4-hydroxy-3-nitrophenylacetaldehyde + H2O2 + NH4(+).", "evidence": [ { "id": "Q8BW75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BW75" } ] }, { "ec_number": "1.4.3.21", "activity": "", "evidence": [ { "id": "Q8BW75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BW75" } ] }, { "ec_number": "1.4.3.4", "activity": "", "evidence": [ { "id": "Q8BW75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BW75" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }