{ "uniprot_canonical_ac": "Q54IP3-1", "uniprot_ac": "Q54IP3", "uniprot_id": "Q54IP3_DICDI", "mass": { "chemical_mass": 31318.0, "monoisotopic_mass": 31318.0 }, "refseq": { "ac": "XP_636636", "name": "hypothetical protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_636636" }, "gene_names": [ { "name": "DDB_G0288619", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q54IP3", "id": "Q54IP3" } ], "protein_names": [ { "name": "RING-type domain-containing protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q54IP3" }, { "name": "hypothetical protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_636636", "id": "XP_636636" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "Q54IP3", "url": "https://www.uniprot.org/uniprot/Q54IP3" } ], "common_name": "Dictyostelium discoideum" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/Q54IP3", "locus": {} } ], "crossref": [ { "id": "DDB_G0288619", "url": "", "database": "", "categories": [ "Organism-specific" ] }, { "id": "8626717", "url": "https://www.ncbi.nlm.nih.gov/gene/8626717", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001841", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001841", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0288619", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0288619", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "RECINNA", "url": "https://omabrowser.org/oma/group/RECINNA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR46016", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46016", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46016:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46016:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13923", "url": "http://pfam.xfam.org/family/PF13923", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-450302", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-450302", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-450321", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-450321", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5689880", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-9020702", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9020702", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-937042", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-937042", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-937072", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-937072", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-975163", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-975163", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_636636", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_636636", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q54IP3", "url": "https://www.uniprot.org/uniprot/Q54IP3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q54IP3-1", "url": "https://www.uniprot.org/uniprot/Q54IP3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNNPFNKNGNNNITFKYLEPEKIDNGLECAICLEVLNDPVVESQCGQMFCRECINNAISVKPICPLCNQMASIGIVAKYVSNKLNEALVTCTLCDDVSSIKRGEYKSMHLDKQCKSQHCEGCGSKFTRSEFDHHIKFDCSMAIVNCSGQDILCPFRSTKSEVSIHEINCYHLSLRTVLSDLIKSNKEKDEKIKKLETQLLFQQNTSGIGIGSNDALVNQQIKNQQFQLLQQQNLLGQTQQQVQQQYFLQQQQLLQQQRQHQLSQLNSFQDGLYRP", "length": 275, "header": "tr|Q54IP3-1|Q54IP3_DICDI Isoform 1 of RING-type domain-containing protein OS=Dictyostelium discoideum OX=44689 GN= PE=4 SV=1 CANONICAL=Q54IP3-1" }, "isoforms": [ { "isoform_ac": "Q54IP3-1", "url": "", "sequence": { "sequence": "MNNPFNKNGNNNITFKYLEPEKIDNGLECAICLEVLNDPVVESQCGQMFCRECINNAISVKPICPLCNQMASIGIVAKYVSNKLNEALVTCTLCDDVSSIKRGEYKSMHLDKQCKSQHCEGCGSKFTRSEFDHHIKFDCSMAIVNCSGQDILCPFRSTKSEVSIHEINCYHLSLRTVLSDLIKSNKEKDEKIKKLETQLLFQQNTSGIGIGSNDALVNQQIKNQQFQLLQQQNLLGQTQQQVQQQYFLQQQQLLQQQRQHQLSQLNSFQDGLYRP", "length": 275, "header": "tr|Q54IP3-1|Q54IP3_DICDI Isoform 1 of RING-type domain-containing protein OS=Dictyostelium discoideum OX=44689 GN= PE=4 SV=1 CANONICAL=Q54IP3-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Chen G., Gibbs R.A., Gloeckner G., Hernandez J., Johnson D., Knights A., Lehmann R., Loulseged H., Ma J., Muzny D.M., Oliver K., Platzer M., Rosenthal A., Saito T., Sodergren E., Steffen D., Sugano S., Walker D., Weinstock G., Lu M., Muzny D., Tanaka Y., Song J., Sodergren E.J., Xu Q., Bankier A.T., Barrell B.G., Williams J., Fey P., Nie X., Gibbs R., Dear P.H., Szafranski K., Davies R., Price C., James K., Noegel A.A., Glockner G., Cooper J., Morio T., Davis P., Williams J.G., Kay R.R., Cronin A., Schleicher M., Olsen R., Kummerfeld S., Sharp S., Hauser H., Weinstock G.M., White B., Quiles M., Rost R., Tunggal B., Pain A., Madan Babu M., Madera M., Rivero F., Saunders D., Eichinger L., Sanders M., Kohara Y., Chisholm R.L., Barrell B., Churcher C.M., Hamlin N., Rajandream M.A., Thangavelu M., Quail M.A., Anjard C., Cox E.C., Haydock S., Kuspa A., Loomis W.F., Shaulsky G., Sucgang R., Urushihara H., Bason N., Berriman M., Buchrieser C., Churcher C., Desany B., Farbrother P., Felder M., Gaudet P., Goodhead I., Hall N., Harper D., Hemphill L., James K.D., Just E., Kerhornou A., Konfortov B.A., Lindsay R., Mourier T., Mungall K., Mungall K.L., Pachebat J.A., Pilcher K., Rabbinowitsch E., Simmonds M., Simmonds M.N., Spiegler S., Tivey A., Wardroper A., Winckler T., Woodward J., Woodward J.R., van Driessche N.", "evidence": [ { "database": "UniProtKB", "id": "Q54IP3", "url": "https://www.uniprot.org/uniprot/Q54IP3" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] } ], "pathway": [ { "id": "ddi:DDB_G0288619", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0288619", "resource": "KEGG Pathway" }, { "id": "R-DDI-450302", "name": "activated TAK1 mediates p38 MAPK activation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-450302", "resource": "Reactome", "description": "activated TAK1 mediates p38 MAPK activation" }, { "id": "R-DDI-450321", "name": "JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-450321", "resource": "Reactome", "description": "JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1" }, { "id": "R-DDI-5689880", "name": "Ub-specific processing proteases", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5689880", "resource": "Reactome", "description": "Ub-specific processing proteases" }, { "id": "R-DDI-9020702", "name": "Interleukin-1 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-9020702", "resource": "Reactome", "description": "Interleukin-1 signaling" }, { "id": "R-DDI-937042", "name": "IRAK2 mediated activation of TAK1 complex", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-937042", "resource": "Reactome", "description": "IRAK2 mediated activation of TAK1 complex" }, { "id": "R-DDI-937072", "name": "TRAF6-mediated induction of TAK1 complex within TLR4 complex", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-937072", "resource": "Reactome", "description": "TRAF6-mediated induction of TAK1 complex within TLR4 complex" }, { "id": "R-DDI-975163", "name": "IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-975163", "resource": "Reactome", "description": "IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation" } ], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [ { "start_pos": 12, "end_pos": 14, "annotation": "n_glycosylation_sequon" }, { "start_pos": 145, "end_pos": 147, "annotation": "n_glycosylation_sequon" }, { "start_pos": 204, "end_pos": 206, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }