{ "uniprot_canonical_ac": "Q4KLY6-1", "uniprot_ac": "Q4KLY6", "uniprot_id": "DCR1B_RAT", "mass": { "chemical_mass": 60924.0, "monoisotopic_mass": 60924.0 }, "refseq": { "ac": "NP_001020858", "name": "5' exonuclease Apollo", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001020858" }, "gene_names": [ { "name": "Dclre1b", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q4KLY6", "id": "Q4KLY6" }, { "name": "Dclre1b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001020858", "id": "NP_001020858" }, { "name": "Snm1b", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q4KLY6", "id": "Q4KLY6" } ], "protein_names": [ { "name": "5' exonuclease Apollo", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q4KLY6" }, { "name": "3.1.-.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q4KLY6" }, { "name": "3.5.2.6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q4KLY6" }, { "name": "5' exonuclease Apollo", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001020858", "id": "NP_001020858" }, { "name": "Beta-lactamase MBLAC2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q4KLY6" }, { "name": "DNA cross-link repair 1B protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q4KLY6" }, { "name": "SNM1 homolog B; DNA cross-link repair 1B protein; beta-lactamase MBLAC2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001020858", "id": "NP_001020858" }, { "name": "SNM1 homolog B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q4KLY6" } ], "function": [ { "annotation": "5'-3' exonuclease that plays a central role in telomere maintenance and protection during S-phase. Participates in the protection of telomeres against non-homologous end-joining (NHEJ)-mediated repair, thereby ensuring that telomeres do not fuse. Plays a key role in telomeric loop (T loop) formation by being recruited by TERF2 at the leading end telomeres and by processing leading-end telomeres immediately after their replication via its exonuclease activity: generates 3' single-stranded overhang at the leading end telomeres avoiding blunt leading-end telomeres that are vulnerable to end-joining reactions and expose the telomere end in a manner that activates the DNA repair pathways. Together with TERF2, required to protect telomeres from replicative damage during replication by controlling the amount of DNA topoisomerase (TOP1, TOP2A and TOP2B) needed for telomere replication during fork passage and prevent aberrant telomere topology. Also involved in response to DNA damage: plays a role in response to DNA interstrand cross-links (ICLs) by facilitating double-strand break formation. In case of spindle stress, involved in prophase checkpoint (By similarity). Possesses beta-lactamase activity, catalyzing the hydrolysis of penicillin G and nitrocefin (By similarity). Exhibits no activity towards other beta-lactam antibiotic classes including cephalosporins (cefotaxime) and carbapenems (imipenem) (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6#function" } ] } ], "disease": [ { "disease_id": "DOID:2729", "recommended_name": { "id": "DOID:2729", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2729", "name": "dyskeratosis congenita", "description": "A skin disease characterized by cutaneous pigmentation, premature graying, dystrophy of the nails, leukoplakia of the oral mucosa, continuous lacrimation due to atresia of the lacrimal ducts, often thrombocytopenia, anemia, testicular atrophy in the male carriers and predisposition to cancer." }, "synonyms": [ { "id": "DOID:2729", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2729", "name": "DKCD", "description": "" }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "dyskeratosis congenita, autosomal dominant 1", "description": "A dyskeratosis congenita that has material basis in an autosomal dominant mutation of TERC on chromosome 3q26.2." }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "DKCA1", "description": "" }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "dyskeratosis congenita, Scoggins type", "description": "" }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "dyskeratosis congenita, autosomal dominant 1", "description": "" }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "dyskeratosis congenita, autosomal dominant type 1", "description": "" }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "DKCA", "description": "" }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "autosomal dominant dyskeratosis congenita", "description": "" }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "autosomal dominant dyskeratosis congenita 1", "description": "" }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "dyskeratosis congenita Scoggins type", "description": "" }, { "id": "MONDO:0007485", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007485", "name": "dyskeratosis congenita autosomal dominant", "description": "" } ], "evidence": [ { "id": "2729", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2729" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "common_name": "Rat" } ], "gene": [ { "name": "Dclre1b", "url": "https://www.uniprot.org/uniprot/Q4KLY6", "locus": { "chromosome": "2", "start_pos": 191309913, "end_pos": 191318423, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000019367", "url": "https://www.ensembl.org/id/ENSRNOG00000019367" } ] } } ], "crossref": [ { "id": "ENSRNOG00000019367", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000019367", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd16273", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16273", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "310745", "url": "https://www.ncbi.nlm.nih.gov/gene/310745", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001279", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001279", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011084", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011084", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036866", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036866", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:310745", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:310745", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "VQQYMNS", "url": "https://omabrowser.org/oma/group/VQQYMNS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "23465at2759", "url": "http://www.orthodb.org/?query=23465at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23240", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23240", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23240:SF26", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23240:SF26", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07522", "url": "http://pfam.xfam.org/family/PF07522", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF12706", "url": "http://pfam.xfam.org/family/PF12706", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q4KLY6", "url": "http://purl.obolibrary.org/obo/PR_Q4KLY6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6783310", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001020858", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001020858", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1310343", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1310343", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "20401", "url": "https://www.rhea-db.org/rhea/20401", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0G2K494", "url": "https://www.uniprot.org/uniprot/A0A0G2K494", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2K494-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K494-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A125", "url": "https://www.uniprot.org/uniprot/A0A8I6A125", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6A125-1", "url": "https://www.uniprot.org/uniprot/A0A8I6A125-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V8I3", "url": "https://www.uniprot.org/uniprot/G3V8I3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V8I3-1", "url": "https://www.uniprot.org/uniprot/G3V8I3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q4KLY6-1", "url": "https://www.uniprot.org/uniprot/Q4KLY6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNGVVIPQTPIAVDFWSLRRAGTARLFFLSHMHCDHTVGLSSTWARPLYCSPITAHLLHRRLQVSKQWIRALEIGESHVLLLDEIGQETMTVTLIDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEATQQIIQLIRQFPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPQRLELVQLLGLADVFTVEEEAGRIHAVDHMEICHSAMLQWNQTHPTIAIFPTSRKIRSPHPSIYSIPYSDHSSYSELRAFVAALRPCQVVPIVREQPCGEFFQDSLSPRLSMPLIPHSVQQYMSSSSRKTNVFWQLERRLKRPRTQGVVFESPEEKADQVKVDRDSKKHKKESLSPWAGCLSRLCPHPLQARKQLFPDFCRKEGDEPVLFCDSNKMATVLTAPLELSVQLQPVDEFPFPETREEIGLGSPLWSGGGSGSPTRGKQSNGMGCGSPPTHISRTTHLTPESGGLALKYLLTPVDFLQAGFSSRNFDQQVEKHQRVQCNNPAVMNTVDDV", "length": 541, "header": "sp|Q4KLY6-1|DCR1B_RAT Isoform 1 of 5' exonuclease Apollo OS=Rattus norvegicus OX=10116 GN=Dclre1b PE=1 SV=2 CANONICAL=Q4KLY6-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K494-1", "url": "", "sequence": { "sequence": "MNGVVIPQTPIAVDFWSLRRAGTARLFFLSHMHCDHTVGLSSTWARPLYCSPITAHLLHRRLQVSKQWIRALEIGESHVLPLDEIGQETMTVTLIDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEATQQIIQLIRQFPQHNIKIGEPFFFHSCLVNLNSWKVFTIFVFVQVSPFLQ", "length": 211, "header": "tr|A0A0G2K494-1|A0A0G2K494_RAT Computationally mapped isoform of DNA cross-link repair 1B OS=Rattus norvegicus OX=10116 GN=Dclre1b PE=1 SV=2 CANONICAL=Q4KLY6-1" }, "locus": { "chromosome": "2", "start_pos": 191318099, "end_pos": 191316299, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000080702.2", "url": "https://www.ensembl.org/id/ENSRNOT00000080702.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000072954.2", "url": "https://www.ensembl.org/id/ENSRNOP00000072954.2" } ] } }, { "isoform_ac": "A0A8I6A125-1", "url": "", "sequence": { "sequence": "MLVPDPGEESTVTRVTNCFPQVSKQWIRALEIGESHVLPLDEIGQETMTVTLIDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEATQQIIQLIRQFPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPQRLELVQLLGLADVFTVEEEAGRIHAVDHMEICHSAMLQWNQTHPTIAIFPTSRKIRSPHPSIYSIPYSDHSSYSELRAFVAALRPCQVVPIVREQPCGEFFQDSLSPRLSMPLIPHSVQQYMSSSSRKTNVFWQLERRLKRPRTQGVVFESPEEKADQVKVDRDSKKHKKESLSPWAGCLSRLCPHPLQARKQLFPDFCRKEGDEPVLFCDSNKMATVLTAPLELSVQLQPVDEFPFPETREEIGLGSPLWSGGGSGSPTRGKQSNGMGCGSPPTHISRTTHLTPESGGLALKYLLTPVDFLQAGFSSRNFDQQVEKHQRVQCNNPAVMNTVDDV", "length": 499, "header": "tr|A0A8I6A125-1|DCR1B_RAT Computationally mapped isoform of 5' exonuclease Apollo OS=Rattus norvegicus OX=10116 GN=Dclre1b PE=1 SV=1 CANONICAL=Q4KLY6-1" }, "locus": { "chromosome": "2", "start_pos": 191317284, "end_pos": 191312072, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000115006.1", "url": "https://www.ensembl.org/id/ENSRNOT00000115006.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000086363.1", "url": "https://www.ensembl.org/id/ENSRNOP00000086363.1" } ] } }, { "isoform_ac": "G3V8I3-1", "url": "", "sequence": { "sequence": "MNGVVIPQTPIAVDFWSLRRAGTARLFFLSHMHCDHTVGLSSTWARPLYCSPITAHLLHRRLQVSKQWIRALEIGESHVLPLDEIGQETMTVTLIDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEATQQIIQLIRQFPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPQRLELVQLLGLADVFTVEEEAGRIHAVDHMEICHSAMLQWNQTHPTIAIFPTSRKIRSPHPSIYSIPYSDHSSYSELRAFVAALRPCQVVPIVREQPCGEFFQDSLSPRLSMPLIPHSVQQYMSSSSRKTNVFWQLERRLKRPRTQGVVFESPEEKADQVKVDRDSKKHKKESLSPWAGCLSRLCPHPLQARKQLFPDFCRKEGDEPVLFCDSNKMATVLTAPLELSVQLQPVDEFPFPETREEIGLGSPLWSGGGSGSPTRGKQSNGMGCGSPPTHISRTTHLTPESGGLALKYLLTPVDFLQAGFSSRNFDQQVEKHQRVQCNNPAVMNTVDDV", "length": 541, "header": "tr|G3V8I3-1|G3V8I3_RAT Computationally mapped isoform of DNA cross-link repair 1B OS=Rattus norvegicus OX=10116 GN=Dclre1b PE=3 SV=3 CANONICAL=Q4KLY6-1" }, "locus": { "chromosome": "2", "start_pos": 191318099, "end_pos": 191312072, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000026213.7", "url": "https://www.ensembl.org/id/ENSRNOT00000026213.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000026213.7", "url": "https://www.ensembl.org/id/ENSRNOP00000026213.7" } ] } }, { "isoform_ac": "Q4KLY6-1", "url": "", "sequence": { "sequence": "MNGVVIPQTPIAVDFWSLRRAGTARLFFLSHMHCDHTVGLSSTWARPLYCSPITAHLLHRRLQVSKQWIRALEIGESHVLLLDEIGQETMTVTLIDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEATQQIIQLIRQFPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPQRLELVQLLGLADVFTVEEEAGRIHAVDHMEICHSAMLQWNQTHPTIAIFPTSRKIRSPHPSIYSIPYSDHSSYSELRAFVAALRPCQVVPIVREQPCGEFFQDSLSPRLSMPLIPHSVQQYMSSSSRKTNVFWQLERRLKRPRTQGVVFESPEEKADQVKVDRDSKKHKKESLSPWAGCLSRLCPHPLQARKQLFPDFCRKEGDEPVLFCDSNKMATVLTAPLELSVQLQPVDEFPFPETREEIGLGSPLWSGGGSGSPTRGKQSNGMGCGSPPTHISRTTHLTPESGGLALKYLLTPVDFLQAGFSSRNFDQQVEKHQRVQCNNPAVMNTVDDV", "length": 541, "header": "sp|Q4KLY6-1|DCR1B_RAT Isoform 1 of 5' exonuclease Apollo OS=Rattus norvegicus OX=10116 GN=Dclre1b PE=1 SV=2 CANONICAL=Q4KLY6-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nat. Commun.", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" }, { "database": "UniProtKB", "id": "A0A0G2K494", "url": "https://www.uniprot.org/uniprot/A0A0G2K494" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] } ], "pathway": [ { "id": "rno:310745", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:310745", "resource": "KEGG Pathway" }, { "id": "R-RNO-6783310", "name": "Fanconi Anemia Pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6783310", "resource": "Reactome", "description": "Fanconi Anemia Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8C7W7-1", "protein_name": "5' exonuclease Apollo", "gene_name": "Dclre1b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNGVVIPQTPIAVDFWSLRRAGSARLFFLTHMHCDHTVGLSSTWARPLYCSPITACLLHRRLQVSKHWIRALEVGESHVLPLDEIGQETMTVTLIDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALILGKQIHTLYLDNTNCNPALVLPSRQEATQQIVQLIRQFPQHNIKIGLYSLGKESLLEQLALEFRTWVVLSPQRLELVQLLGLADVFTVEEEAGRIHAVDHTEICHSAMLQWNQSHPTIAIFPTSRKVRSPHPSIYTVPYSDHSSYSELRAFVAALRPCQVVPIVHQKPCGEFFQDSLSPRLAMPLIPHSVQQYMSSSSRKTNVLWQLERRLKRPRTQGVVFESPEEKANQVKVDRDSKKHKKENLSPWAGHLERLCPHPLQARKQLFPDFCRKERDEPVLFCDSNKMATVLTAPLEFSVQLQPIDEFLFPETREKIGLESPLLSRGDSGSPARGNQSDCVGCGSPPAHISRAVPLTPESRGLALKYLLTPVHFLQAGFSSRNFDKQVEKHQRVQRSSPAVLSPVDVG", "length": 541 }, "evidence": [ { "id": "45234239", "url": "http://www.informatics.jax.org/homology/45234239", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9H816-1", "protein_name": "5' exonuclease Apollo", "gene_name": "DCLRE1B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MNGVLIPHTPIAVDFWSLRRAGTARLFFLSHMHSDHTVGLSSTWARPLYCSPITAHLLHRHLQVSKQWIQALEVGESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEAAHQIVQLIRKHPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPRRLELVQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYSELRAFVAALKPCQVVPIVSRRPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQGVVFESPEESADQSQADRDSKKAKKEKLSPWPADLEKQPSHHPLRIKKQLFPDLYSKEWNKAVPFCESQKRVTMLTAPLGFSVHLRSTDEEFISQKTREEIGLGSPLVPMGDDDGGPEATGNQSAWMGHGSPLSHSSKGTPLLATEFRGLALKYLLTPVNFFQAGYSSRRFDQQVEKYHKPC", "length": 532 }, "evidence": [ { "id": "45234239", "url": "http://www.informatics.jax.org/homology/45234239", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "telomere maintenance via telomere lengthening", "id": "GO:0010833", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010833", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" }, { "name": "telomere maintenance", "id": "GO:0000723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000723", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" }, { "name": "telomere capping", "id": "GO:0016233", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016233", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" }, { "name": "protection from non-homologous end joining at telomere", "id": "GO:0031848", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031848", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" }, { "name": "double-strand break repair via nonhomologous end joining", "id": "GO:0006303", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006303", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" }, { "name": "interstrand cross-link repair", "id": "GO:0036297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036297", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" }, { "name": "telomeric loop formation", "id": "GO:0031627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031627", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" }, { "name": "telomeric 3' overhang formation", "id": "GO:0031860", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031860", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" }, { "name": "centrosome", "id": "GO:0005813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005813", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" }, { "name": "chromosome, telomeric region", "id": "GO:0000781", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000781", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" }, { "name": "nuclear body", "id": "GO:0016604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016604", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" }, { "name": "damaged DNA binding", "id": "GO:0003684", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003684", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" }, { "name": "5'-3' DNA exonuclease activity", "id": "GO:0035312", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035312", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" }, { "name": "5'-3' exonuclease activity", "id": "GO:0008409", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008409", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" }, { "name": "beta-lactamase activity", "id": "GO:0008800", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008800", "evidence": [ { "database": "UniProtKB", "id": "Q4KLY6", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 246, "end_pos": 248, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "20401", "name": "", "equation": "a beta-lactam + H2O = a substituted beta-amino acid", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q4KLY6-1", "P31430-1", "P16444-1", "Q6PJP8-1", "Q68D91-1", "Q9H816-1", "Q8C7W7-1", "Q8BL86-1", "Q9JIC3-1", "P31428-1" ], "evidence": [ { "id": "20401", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/20401" } ] }, { "id": "R-RNO-6785732", "name": "DNA nucleases bind monoubiquitinated ID2 complex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q569C3-1", "Q5PQP5-1", "Q4KLY6-1", "Q4KM32-1", "D3ZVU2-1" ], "evidence": [ { "id": "R-RNO-6785732", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6785732" } ] }, { "id": "R-RNO-6785986", "name": "DNA nucleases unhook the interstrand crosslink (ICL)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5PQP5-1", "Q4KLY6-1", "Q4KM32-1", "D3ZVU2-1" ], "evidence": [ { "id": "R-RNO-6785986", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-6785986" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "D3ZVU2", "gene_name": "Fan1", "activity": [ { "ec_number": "3.1.4.1", "activity": "Hydrolytically removes 5'-nucleotides successively from the 3'-hydroxy termini of 3'-hydroxy-terminated oligonucleotides.", "evidence": [ { "id": "D3ZVU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZVU2" } ] }, { "ec_number": "3.1.4.1", "activity": "", "evidence": [ { "id": "D3ZVU2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZVU2" } ] } ] }, { "uniprot_ac": "P16444", "gene_name": "DPEP1", "activity": [ { "ec_number": "3.4.13.19", "activity": "an L-aminoacyl-L-amino acid + H2O = 2 an L-alpha-amino acid.", "evidence": [ { "id": "P16444", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16444" } ] }, { "ec_number": "3.4.13.19", "activity": "", "evidence": [ { "id": "P16444", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16444" } ] }, { "ec_number": "3.5.2.6", "activity": "a beta-lactam + H2O = a substituted beta-amino acid.", "evidence": [ { "id": "P16444", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16444" } ] } ] }, { "uniprot_ac": "P31428", "gene_name": "Dpep1", "activity": [ { "ec_number": "3.4.13.19", "activity": "an L-aminoacyl-L-amino acid + H2O = 2 an L-alpha-amino acid.", "evidence": [ { "id": "P31428", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31428" } ] }, { "ec_number": "3.4.13.19", "activity": "", "evidence": [ { "id": "P31428", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31428" } ] }, { "ec_number": "3.5.2.6", "activity": "a beta-lactam + H2O = a substituted beta-amino acid.", "evidence": [ { "id": "P31428", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31428" } ] } ] }, { "uniprot_ac": "P31430", "gene_name": "Dpep1", "activity": [ { "ec_number": "3.4.13.19", "activity": "an L-aminoacyl-L-amino acid + H2O = 2 an L-alpha-amino acid.", "evidence": [ { "id": "P31430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31430" } ] }, { "ec_number": "3.5.2.6", "activity": "a beta-lactam + H2O = a substituted beta-amino acid.", "evidence": [ { "id": "P31430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31430" } ] }, { "ec_number": "3.4.13.19", "activity": "", "evidence": [ { "id": "P31430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P31430" } ] } ] }, { "uniprot_ac": "Q4KLY6", "gene_name": "Dclre1b", "activity": [ { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "Q4KLY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ] }, { "ec_number": "3.5.2.6", "activity": "a beta-lactam + H2O = a substituted beta-amino acid.", "evidence": [ { "id": "Q4KLY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KLY6" } ] } ] }, { "uniprot_ac": "Q4KM32", "gene_name": "Mus81", "activity": [ { "ec_number": "3.1.22.-", "activity": "", "evidence": [ { "id": "Q4KM32", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4KM32" } ] } ] }, { "uniprot_ac": "Q569C3", "gene_name": "Usp1", "activity": [ { "ec_number": "3.4.19.12", "activity": "Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).", "evidence": [ { "id": "Q569C3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q569C3" } ] }, { "ec_number": "3.4.19.12", "activity": "", "evidence": [ { "id": "Q569C3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q569C3" } ] } ] }, { "uniprot_ac": "Q5PQP5", "gene_name": "Slx1b", "activity": [ { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "Q5PQP5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5PQP5" } ] } ] }, { "uniprot_ac": "Q68D91", "gene_name": "MBLAC2", "activity": [ { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "Q68D91", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68D91" } ] }, { "ec_number": "3.5.2.6", "activity": "a beta-lactam + H2O = a substituted beta-amino acid.", "evidence": [ { "id": "Q68D91", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68D91" } ] }, { "ec_number": "3.1.2.2", "activity": "", "evidence": [ { "id": "Q68D91", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68D91" } ] } ] }, { "uniprot_ac": "Q6PJP8", "gene_name": "DCLRE1A", "activity": [ { "ec_number": "3.5.2.6", "activity": "a beta-lactam + H2O = a substituted beta-amino acid.", "evidence": [ { "id": "Q6PJP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PJP8" } ] } ] }, { "uniprot_ac": "Q8BL86", "gene_name": "Mblac2", "activity": [ { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "Q8BL86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BL86" } ] }, { "ec_number": "3.5.2.6", "activity": "a beta-lactam + H2O = a substituted beta-amino acid.", "evidence": [ { "id": "Q8BL86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BL86" } ] }, { "ec_number": "3.1.2.2", "activity": "", "evidence": [ { "id": "Q8BL86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BL86" } ] } ] }, { "uniprot_ac": "Q8C7W7", "gene_name": "Dclre1b", "activity": [ { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "Q8C7W7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C7W7" } ] }, { "ec_number": "3.5.2.6", "activity": "a beta-lactam + H2O = a substituted beta-amino acid.", "evidence": [ { "id": "Q8C7W7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C7W7" } ] } ] }, { "uniprot_ac": "Q9H816", "gene_name": "DCLRE1B", "activity": [ { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "Q9H816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H816" } ] }, { "ec_number": "3.5.2.6", "activity": "a beta-lactam + H2O = a substituted beta-amino acid.", "evidence": [ { "id": "Q9H816", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H816" } ] } ] }, { "uniprot_ac": "Q9JIC3", "gene_name": "Dclre1a", "activity": [ { "ec_number": "3.5.2.6", "activity": "a beta-lactam + H2O = a substituted beta-amino acid.", "evidence": [ { "id": "Q9JIC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIC3" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }