{ "uniprot_canonical_ac": "Q499N5-1", "uniprot_ac": "Q499N5", "uniprot_id": "ACSF2_RAT", "mass": { "chemical_mass": 67886.0, "monoisotopic_mass": 67886.0 }, "refseq": { "ac": "NP_001030123", "name": "medium-chain acyl-CoA ligase ACSF2, mitochondrial precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030123" }, "gene_names": [ { "name": "Acsf2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q499N5", "id": "Q499N5" }, { "name": "Acsf2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030123", "id": "NP_001030123" } ], "protein_names": [ { "name": "Medium-chain acyl-CoA ligase ACSF2, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q499N5" }, { "name": "6.2.1.2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q499N5" }, { "name": "acyl-CoA synthetase family member 2, mitochondrial; medium-chain acyl-CoA ligase ACSF2, mitochondrial", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030123", "id": "NP_001030123" }, { "name": "medium-chain acyl-CoA ligase ACSF2, mitochondrial precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030123", "id": "NP_001030123" } ], "function": [ { "annotation": "Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA. Has some preference toward medium-chain substrates. Plays a role in adipocyte differentiation.", "evidence": [ { "database": "UniProtKB", "id": "Q499N5", "url": "https://www.uniprot.org/uniprot/Q499N5#function" }, { "database": "UniProtKB", "id": "Q96CM8", "url": "https://www.uniprot.org/uniprot/Q96CM8#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q499N5", "url": "https://www.uniprot.org/uniprot/Q499N5" } ], "common_name": "Rat" } ], "gene": [ { "name": "Acsf2", "url": "https://www.uniprot.org/uniprot/Q499N5", "locus": { "chromosome": "10", "start_pos": 79504511, "end_pos": 79546673, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000003330", "url": "https://www.ensembl.org/id/ENSRNOG00000003330" } ] } } ], "crossref": [ { "id": "ENSRNOG00000003330", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000003330", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd05917", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05917", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "619561", "url": "https://www.ncbi.nlm.nih.gov/gene/619561", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000873", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000873", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020845", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020845", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR025110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042099", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042099", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045851", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045851", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:619561", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:619561", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q499N5", "url": "https://oglcnac.org/atlas/detail/Q499N5", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "Q499N5", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q499N5", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "KQSDMKA", "url": "https://omabrowser.org/oma/group/KQSDMKA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2596785at2759", "url": "http://www.orthodb.org/?query=2596785at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR43201", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43201", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43201:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43201:SF9", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00501", "url": "http://pfam.xfam.org/family/PF00501", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13193", "url": "http://pfam.xfam.org/family/PF13193", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q499N5", "url": "http://purl.obolibrary.org/obo/PR_Q499N5", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-77289", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001030123", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030123", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1562656", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1562656", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "33631", "url": "https://www.rhea-db.org/rhea/33631", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "48340", "url": "https://www.rhea-db.org/rhea/48340", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A8I6ANW0", "url": "https://www.uniprot.org/uniprot/A0A8I6ANW0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6ANW0-1", "url": "https://www.uniprot.org/uniprot/A0A8I6ANW0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GEJ7", "url": "https://www.uniprot.org/uniprot/A0A8I6GEJ7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I6GEJ7-1", "url": "https://www.uniprot.org/uniprot/A0A8I6GEJ7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q499N5", "url": "https://www.uniprot.org/uniprot/Q499N5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q499N5-1", "url": "https://www.uniprot.org/uniprot/Q499N5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAVYLGMLRLGRLCVASLGARGPRTPLSRPWPNSKLQGVRAFSSGMVDCTNPLPIGGLSYIQGHTDSHLVNKTVGECLDATAQRFPNREALVIIHENIRLNFAQLKEEVDRAASGLLSIGLRKGDRLGMWGPNSYAWVLIQLATAQAGIILVSVNPAYQASELEYVLRKVGCKGIVFPKQFKTQQYYNILKQVCPELEKAQPGALKSERLPDLTTVISVDAPLPGTLLLDEVVAAGGKEQNLAQLRYHQGFLSCYDPINIQFTSGTTGNPKGATLSHHNIVNNSNLIGQRLKMPAKTAEELRMVLPCPLYHCLGSVGGTMVSVVHGATLLLSSPSFNGKKALEAISREKGTLLYGTPTMFVDILNQPDFSSYDFTTIRGGVIAGSLAPPELIRAIISKMNMKELVVVYGTTENSPVTFMNFPEDTLEQKAGSVGRIMPHTEAQIVNMETGELTKLNMPGELCIRGYCVMQGYWGEPQKTFETVGQDRWYRTGDIASMDEQGFCRIVGRSKDMIIRGGENIYPAELEDFFHKHPQVQEAQVVGVKDDRMGEEICACIRLKSGETTTEEEIKAFCKGKISHFKIPRYIVFVEGYPLTVSGKIQKFKLREQMEQHLKL", "length": 615, "header": "sp|Q499N5-1|ACSF2_RAT Isoform 1 of Medium-chain acyl-CoA ligase ACSF2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acsf2 PE=2 SV=1 CANONICAL=Q499N5-1" }, "isoforms": [ { "isoform_ac": "A0A8I6ANW0-1", "url": "", "sequence": { "sequence": "MAVYLGMLRLGRLCVASLGARGPRTPLSRPWPNSKLQGVRAFSSGMVDCTNPLPIGGLSYIQGHTDSHLVNKTVGECLDATAQRFPNREALVIIHENIRLNFAQLKEEVDRAASGLLSIGLRKGDRLGMWGPNSYAWVLIQLATAQAGIILVSVNPAYQASELEYVLRKVGCKGIVFPKQFKTQQYYNILKQVCPELEKAQPGALKSERLPDLTTVISVDAPLPGTLLLDEVVAAGGKEQNLAQLRYHQGFLSCYDPINIQFTSGTTGNPKGATLSHHNIVNNSNLIGQRLKMPAKTAEELRMVLPCPLYHCLGSVGGTMVSVVHGATLLLSSPSFNGKKALEAISREKGTLLYGTPTMFVDILNQPDFSSYDFTTIRGGWVTTVVYGTTENSPVTFMNFPEDTLEQKAGSVGRIMPHTEAQIVNMETGELTKLNMPGELCIRGYCVMQGYWGEPQKTFETVGQDRWYRTGDIASMDEQGFCRIVGRSKDMIIRGGENIYPAELEDFFHKHPQVQEAQVVGVKDDRMGEEICACIRLKSGETTTEEEIKAFCKGKISHFKIPRYIVFVEGYPLTVSGKIQKFKLREQMEQHLKL", "length": 594, "header": "tr|A0A8I6ANW0-1|A0A8I6ANW0_RAT Computationally mapped isoform of Acyl-CoA synthetase family member 2 OS=Rattus norvegicus OX=10116 GN=Acsf2 PE=1 SV=1 CANONICAL=Q499N5-1" }, "locus": { "chromosome": "10", "start_pos": 79546543, "end_pos": 79505621, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000116540.1", "url": "https://www.ensembl.org/id/ENSRNOT00000116540.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000095809.1", "url": "https://www.ensembl.org/id/ENSRNOP00000095809.1" } ] } }, { "isoform_ac": "A0A8I6GEJ7-1", "url": "", "sequence": { "sequence": "MAVYLGMLRLGRLCVASLGARGPRTPLSRPWPNSKLQGVRAFSSGMVDCTNPLPIGGLSYIQGHTDSHLVNKTVGECLDATAQRFPNREALVIIHENIRLNFAQLKEEVDRAASGLLSIGLRKGDRLGMWGPNSYAWVLIQLATAQAGIILVGCKGIVFPKQFKTQQYYNILKQVCPELEKAQPGALKSERLPDLTTVISVDAPLPGTLLLDEVVAAGGKEQNLAQLRYHQGFLSCYDPINIQFTSGTTGNPKGATLSHHNIVNNSNLIGQRLKMPAKTAEELRMVLPCPLYHCLGSVGGTMVSVVHGATLLLSSPSFNGKKALEAISREKGTLLYGTPTMFVDILNQPDFSSYDFTTIRGGVIAGSLAPPELIRAIISKMNMKELVVVYGTTENSPVTFMNFPEDTLEQKAGSVGRIMPHTEAQIVNMETGELTKLNMPGELCIRGYCVMQGYWGEPQKTFETVGQDRWYRTGDIASMDEQGFCRIVGRSKDMIIRGGENIYPAELEDFFHKHPQVQEAQVVGVKDDRMGEEICACIRLKSGETTTEEEIKAFCKGKISHFKIPRYIVFVEGYPLTVSGKIQKFKLREQMEQHLKL", "length": 597, "header": "tr|A0A8I6GEJ7-1|A0A8I6GEJ7_RAT Computationally mapped isoform of Acyl-CoA synthetase family member 2 OS=Rattus norvegicus OX=10116 GN=Acsf2 PE=1 SV=1 CANONICAL=Q499N5-1" }, "locus": { "chromosome": "10", "start_pos": 79546543, "end_pos": 79505621, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000093983.1", "url": "https://www.ensembl.org/id/ENSRNOT00000093983.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000086908.1", "url": "https://www.ensembl.org/id/ENSRNOP00000086908.1" } ] } }, { "isoform_ac": "Q499N5-1", "url": "", "sequence": { "sequence": "MAVYLGMLRLGRLCVASLGARGPRTPLSRPWPNSKLQGVRAFSSGMVDCTNPLPIGGLSYIQGHTDSHLVNKTVGECLDATAQRFPNREALVIIHENIRLNFAQLKEEVDRAASGLLSIGLRKGDRLGMWGPNSYAWVLIQLATAQAGIILVSVNPAYQASELEYVLRKVGCKGIVFPKQFKTQQYYNILKQVCPELEKAQPGALKSERLPDLTTVISVDAPLPGTLLLDEVVAAGGKEQNLAQLRYHQGFLSCYDPINIQFTSGTTGNPKGATLSHHNIVNNSNLIGQRLKMPAKTAEELRMVLPCPLYHCLGSVGGTMVSVVHGATLLLSSPSFNGKKALEAISREKGTLLYGTPTMFVDILNQPDFSSYDFTTIRGGVIAGSLAPPELIRAIISKMNMKELVVVYGTTENSPVTFMNFPEDTLEQKAGSVGRIMPHTEAQIVNMETGELTKLNMPGELCIRGYCVMQGYWGEPQKTFETVGQDRWYRTGDIASMDEQGFCRIVGRSKDMIIRGGENIYPAELEDFFHKHPQVQEAQVVGVKDDRMGEEICACIRLKSGETTTEEEIKAFCKGKISHFKIPRYIVFVEGYPLTVSGKIQKFKLREQMEQHLKL", "length": 615, "header": "sp|Q499N5-1|ACSF2_RAT Isoform 1 of Medium-chain acyl-CoA ligase ACSF2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acsf2 PE=2 SV=1 CANONICAL=Q499N5-1" }, "locus": { "chromosome": "10", "start_pos": 79546543, "end_pos": 79505621, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000004673", "url": "https://www.ensembl.org/id/ENSRNOT00000004673" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000004673", "url": "https://www.ensembl.org/id/ENSRNOP00000004673" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 385, "start_aa": "Ser", "end_pos": 385, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser385", "evidence": [ { "id": "Q499N5", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q499N5" }, { "id": "27213235", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27213235" }, { "id": "26446791", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26446791" }, { "id": "34502162", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34502162" }, { "id": "Q499N5", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q499N5" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 578, "start_aa": "Ser", "end_pos": 578, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser578", "evidence": [ { "id": "Q499N5", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q499N5" }, { "id": "27213235", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27213235" }, { "id": "26446791", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26446791" }, { "id": "34502162", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34502162" }, { "id": "Q499N5", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q499N5" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "O-GlcNAcomic Profiling Identifies Widespread O-Linked beta-N-Acetylglucosamine Modification (O-GlcNAcylation) in Oxidative Phosphorylation System Regulating Cardiac Mitochondrial Function.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Ma J, Liu T, Wei AC, Banerjee P, O'Rourke B, Hart GW", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q499N5", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q499N5" }, { "database": "O-GlcNAc Atlas", "id": "Q499N5", "url": "https://oglcnac.org/atlas/detail/Q499N5" } ], "reference": [ { "type": "PubMed", "id": "26446791", "url": "https://glygen.org/publication/PubMed/26446791" } ] }, { "title": "Comparative Proteomics Reveals Dysregulated Mitochondrial O-GlcNAcylation in Diabetic Hearts.", "journal": "Journal of proteome research", "date": "2016", "authors": "Ma J, Banerjee P, Whelan SA, Liu T, Wei AC, Ramirez-Correa G, McComb ME, Costello CE, O'Rourke B, Murphy A, Hart GW", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q499N5", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q499N5" }, { "database": "O-GlcNAc Atlas", "id": "Q499N5", "url": "https://oglcnac.org/atlas/detail/Q499N5" } ], "reference": [ { "type": "PubMed", "id": "27213235", "url": "https://glygen.org/publication/PubMed/27213235" } ] }, { "title": "An O-GlcNAcylomic Approach Reveals ACLY as a Potential Target in Sepsis in the Young Rat.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Denis M, Dupas T, Persello A, Dontaine J, Bultot L, Betus C, Pele T, Dhot J, Erraud A, Maillard A, Montnach J, Leroux AA, Bigot-Corbel E, Vertommen D, Riviere M, Lebreton J, Tessier A, Waard M, Bertrand L, Rozec B, Lauzier B", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q499N5", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q499N5" } ], "reference": [ { "type": "PubMed", "id": "34502162", "url": "https://glygen.org/publication/PubMed/34502162" } ] } ], "pathway": [ { "id": "rno:619561", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:619561", "resource": "KEGG Pathway" }, { "id": "R-RNO-77289", "name": "Mitochondrial Fatty Acid Beta-Oxidation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-77289", "resource": "Reactome", "description": "Mitochondrial Fatty Acid Beta-Oxidation" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8VCW8-1", "protein_name": "Medium-chain acyl-CoA ligase ACSF2, mitochondrial", "gene_name": "Acsf2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAVYHGMLRFGRLCIASLGARGPRTLLSRPRPNSKLQSVRALSSGMVNCTNPLPIGGLSYIQGHTDSHLVNTTVGECLDATAQRFPDREALVILHENIRLNFAQLKEEVDKAASGLLSIGLRKGDRLGMWGPNSYAWVLIQLATAQAGIILVSVNPAYQSSELEYVLRKVGCKGIVFPKQFKTQQYYDILKQVCPELEKAQPGALKSERLPDLTTVISVDAPLPGTLLLDDIVAAGGKEQNLAQLRYNQRFLSCYDPINIQFTSGTTGNPKGATLSHHNIVNNSMLIGQRLKMPTKTAEELRLVLPSPLYHCLGSVGGTMVSMMHGATLLLSSPSFNGKKALEAISREKGTLLYGTPTMFVDILNQPDFSSYDFTSIRGGVIAGSPAPPELIRAIINKMNMKELVVVYGTTENSPVTFMNFPEDTLEQKAGSVGRIMPHTEAQIVNVETGELTNLNVPGELYIRGYCVMQGYWGEPQKTFETVGQDKWYRTGDIALMDEQGFCKIVGRSKDMIIRGGENIYPAELEDFFLKHPQVQEAQVVGVKDERMGEEICACIRLKSGETTTAEEIKAFCKGKISHFKIPRYIVFVEGYPLTISGKIQKFKLREQMEQHLKL", "length": 615 }, "evidence": [ { "id": "45234163", "url": "http://www.informatics.jax.org/homology/45234163", "database": "MGI" }, { "id": "Q499N5", "url": "https://omabrowser.org/oma/group/Q499N5/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q96CM8-1", "protein_name": "Medium-chain acyl-CoA ligase ACSF2, mitochondrial", "gene_name": "ACSF2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAVYVGMLRLGRLCAGSSGVLGARAALSRSWQEARLQGVRFLSSREVDRMVSTPIGGLSYVQGCTKKHLNSKTVGQCLETTAQRVPEREALVVLHEDVRLTFAQLKEEVDKAASGLLSIGLCKGDRLGMWGPNSYAWVLMQLATAQAGIILVSVNPAYQAMELEYVLKKVGCKALVFPKQFKTQQYYNVLKQICPEVENAQPGALKSQRLPDLTTVISVDAPLPGTLLLDEVVAAGSTRQHLDQLQYNQQFLSCHDPINIQFTSGTTGSPKGATLSHYNIVNNSNILGERLKLHEKTPEQLRMILPNPLYHCLGSVAGTMMCLMYGATLILASPIFNGKKALEAISRERGTFLYGTPTMFVDILNQPDFSSYDISTMCGGVIAGSPAPPELIRAIINKINMKDLVVAYGTTENSPVTFAHFPEDTVEQKAESVGRIMPHTEARIMNMEAGTLAKLNTPGELCIRGYCVMLGYWGEPQKTEEAVDQDKWYWTGDVATMNEQGFCKIVGRSKDMIIRGGENIYPAELEDFFHTHPKVQEVQVVGVKDDRMGEEICACIRLKDGEETTVEEIKAFCKGKISHFKIPKYIVFVTNYPLTISGKIQKFKLREQMERHLNL", "length": 615 }, "evidence": [ { "id": "45234163", "url": "http://www.informatics.jax.org/homology/45234163", "database": "MGI" }, { "id": "Q499N5", "url": "https://omabrowser.org/oma/group/Q499N5/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "Q499N5", "url": "https://www.uniprot.org/uniprot/Q499N5" } ], "pmid": "" }, { "name": "butyrate-CoA ligase activity", "id": "GO:0047760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047760", "evidence": [ { "database": "UniProtKB", "id": "Q499N5", "url": "https://www.uniprot.org/uniprot/Q499N5" } ], "pmid": "" }, { "name": "medium-chain fatty acid-CoA ligase activity", "id": "GO:0031956", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031956", "evidence": [ { "database": "UniProtKB", "id": "Q499N5", "url": "https://www.uniprot.org/uniprot/Q499N5" } ], "pmid": "" }, { "name": "catalytic activity", "id": "GO:0003824", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003824", "evidence": [ { "database": "UniProtKB", "id": "Q499N5", "url": "https://www.uniprot.org/uniprot/Q499N5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q499N5", "url": "https://www.uniprot.org/uniprot/Q499N5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "fatty acid metabolic process", "id": "GO:0006631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006631", "evidence": [ { "database": "UniProtKB", "id": "Q499N5", "url": "https://www.uniprot.org/uniprot/Q499N5" } ], "pmid": "" }, { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "Q499N5", "url": "https://www.uniprot.org/uniprot/Q499N5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 282, "end_pos": 284, "annotation": "n_glycosylation_sequon" }, { "start_pos": 71, "end_pos": 73, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "33631", "name": "", "equation": "ATP + CoA + octanoate = AMP + diphosphate + octanoyl-CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O70490-1", "Q7TN78-1", "Q499N5-1", "Q6SKG1-1", "P0C7M7-1", "Q08AH1-1", "Q08AH3-1", "Q96CM8-1", "Q68CK6-1", "Q53FZ2-1", "Q91VA0-1", "Q8VCW8-1", "Q8K0L3-1", "Q80W40-1", "Q3UNX5-1", "P39518-1" ], "evidence": [ { "id": "33631", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/33631" } ] }, { "id": "48340", "name": "", "equation": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O70490-1", "Q7TN78-1", "Q499N5-1", "Q6AYT9-1", "Q6SKG1-1", "Q63151-1", "Q6NUN0-1", "Q53FZ2-1", "Q6P461-1", "P0C7M7-1", "Q08AH1-1", "Q08AH3-1", "Q96CM8-1", "Q68CK6-1", "O95573-1", "Q91VA0-1", "Q8VCW8-1", "Q8BGA8-1", "Q8K0L3-1", "Q80W40-1", "Q3UNX5-1", "Q9CZW4-1" ], "evidence": [ { "id": "48340", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/48340" } ] }, { "id": "R-RNO-5696004", "name": "ACSF2 ligates CoA-SH to MCFA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial matrix", "input_participant_list": [ "R-ALL-5690531" ], "output_participant_list": [ "R-ALL-5690542" ], "enzyme_list": [ "Q499N5-1" ], "evidence": [ { "id": "R-RNO-5696004", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5696004" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-5690531", "participant_name": "MCFA [mitochondrial matrix]", "crossref": [ { "id": "59554", "database": "ChEBI", "url": "" }, { "id": "59554", "database": "ChEBI", "url": "" }, { "id": "59554", "database": "ChEBI", "url": "" }, { "id": "59554", "database": "ChEBI", "url": "" }, { "id": "59554", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-5690542", "participant_name": "MCFA-CoA [mitochondrial matrix]", "crossref": [ { "id": "61907", "database": "ChEBI", "url": "" }, { "id": "61907", "database": "ChEBI", "url": "" }, { "id": "61907", "database": "ChEBI", "url": "" }, { "id": "61907", "database": "ChEBI", "url": "" }, { "id": "61907", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O70490", "gene_name": "Acsm2", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O70490", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70490" } ] }, { "ec_number": "6.2.1.25", "activity": "ATP + benzoate + CoA = AMP + benzoyl-CoA + diphosphate.", "evidence": [ { "id": "O70490", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70490" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "O70490", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70490" } ] } ] }, { "uniprot_ac": "O95573", "gene_name": "ACSL3", "activity": [ { "ec_number": "6.2.1.3", "activity": "a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O95573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95573" } ] }, { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O95573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95573" } ] }, { "ec_number": "6.2.1.15", "activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + ATP + CoA = (5Z,8Z,11Z,14Z)-eicosatetraenoyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O95573", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95573" } ] } ] }, { "uniprot_ac": "P0C7M7", "gene_name": "ACSM4", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "P0C7M7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C7M7" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "P0C7M7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C7M7" } ] } ] }, { "uniprot_ac": "P39518", "gene_name": "FAA2", "activity": [ { "ec_number": "6.2.1.3", "activity": "a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "P39518", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39518" } ] }, { "ec_number": "6.2.1.3", "activity": "", "evidence": [ { "id": "P39518", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39518" } ] } ] }, { "uniprot_ac": "Q08AH1", "gene_name": "ACSM1", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q08AH1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08AH1" } ] }, { "ec_number": "6.2.1.25", "activity": "ATP + benzoate + CoA = AMP + benzoyl-CoA + diphosphate.", "evidence": [ { "id": "Q08AH1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08AH1" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "Q08AH1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08AH1" } ] } ] }, { "uniprot_ac": "Q08AH3", "gene_name": "ACSM2A", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q08AH3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08AH3" } ] }, { "ec_number": "6.2.1.25", "activity": "ATP + benzoate + CoA = AMP + benzoyl-CoA + diphosphate.", "evidence": [ { "id": "Q08AH3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08AH3" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "Q08AH3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08AH3" } ] } ] }, { "uniprot_ac": "Q3UNX5", "gene_name": "Acsm3", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q3UNX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UNX5" } ] }, { "ec_number": "6.2.1.17", "activity": "ATP + CoA + propanoate = AMP + diphosphate + propanoyl-CoA.", "evidence": [ { "id": "Q3UNX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UNX5" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "Q3UNX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UNX5" } ] } ] }, { "uniprot_ac": "Q499N5", "gene_name": "Acsf2", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q499N5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q499N5" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "Q499N5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q499N5" } ] } ] }, { "uniprot_ac": "Q53FZ2", "gene_name": "ACSM3", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q53FZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q53FZ2" } ] }, { "ec_number": "6.2.1.17", "activity": "ATP + CoA + propanoate = AMP + diphosphate + propanoyl-CoA.", "evidence": [ { "id": "Q53FZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q53FZ2" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "Q53FZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q53FZ2" } ] } ] }, { "uniprot_ac": "Q63151", "gene_name": "Acsl3", "activity": [ { "ec_number": "6.2.1.3", "activity": "a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q63151", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63151" } ] }, { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q63151", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63151" } ] }, { "ec_number": "6.2.1.15", "activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + ATP + CoA = (5Z,8Z,11Z,14Z)-eicosatetraenoyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q63151", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63151" } ] } ] }, { "uniprot_ac": "Q68CK6", "gene_name": "ACSM2B", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q68CK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68CK6" } ] }, { "ec_number": "6.2.1.25", "activity": "ATP + benzoate + CoA = AMP + benzoyl-CoA + diphosphate.", "evidence": [ { "id": "Q68CK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68CK6" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "Q68CK6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68CK6" } ] } ] }, { "uniprot_ac": "Q6AYT9", "gene_name": "Acsm5", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q6AYT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYT9" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "Q6AYT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYT9" } ] } ] }, { "uniprot_ac": "Q6NUN0", "gene_name": "ACSM5", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q6NUN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NUN0" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "Q6NUN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NUN0" } ] } ] }, { "uniprot_ac": "Q6P461", "gene_name": "ACSM6", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q6P461", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P461" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "Q6P461", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P461" } ] } ] }, { "uniprot_ac": "Q6SKG1", "gene_name": "Acsm3", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q6SKG1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6SKG1" } ] }, { "ec_number": "6.2.1.17", "activity": "ATP + CoA + propanoate = AMP + diphosphate + propanoyl-CoA.", "evidence": [ { "id": "Q6SKG1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6SKG1" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "Q6SKG1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6SKG1" } ] } ] }, { "uniprot_ac": "Q7TN78", "gene_name": "Acsm4", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q7TN78", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TN78" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "Q7TN78", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TN78" } ] } ] }, { "uniprot_ac": "Q80W40", "gene_name": "Acsm4", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q80W40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80W40" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "Q80W40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80W40" } ] } ] }, { "uniprot_ac": "Q8BGA8", "gene_name": "Acsm5", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q8BGA8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGA8" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "Q8BGA8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGA8" } ] } ] }, { "uniprot_ac": "Q8K0L3", "gene_name": "Acsm2", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q8K0L3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K0L3" } ] }, { "ec_number": "6.2.1.25", "activity": "ATP + benzoate + CoA = AMP + benzoyl-CoA + diphosphate.", "evidence": [ { "id": "Q8K0L3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K0L3" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "Q8K0L3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K0L3" } ] } ] }, { "uniprot_ac": "Q8VCW8", "gene_name": "Acsf2", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q8VCW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCW8" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "Q8VCW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCW8" } ] } ] }, { "uniprot_ac": "Q91VA0", "gene_name": "Acsm1", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q91VA0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VA0" } ] }, { "ec_number": "6.2.1.25", "activity": "ATP + benzoate + CoA = AMP + benzoyl-CoA + diphosphate.", "evidence": [ { "id": "Q91VA0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VA0" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "Q91VA0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VA0" } ] } ] }, { "uniprot_ac": "Q96CM8", "gene_name": "ACSF2", "activity": [ { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q96CM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96CM8" } ] }, { "ec_number": "6.2.1.2", "activity": "", "evidence": [ { "id": "Q96CM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96CM8" } ] } ] }, { "uniprot_ac": "Q9CZW4", "gene_name": "Acsl3", "activity": [ { "ec_number": "6.2.1.3", "activity": "a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q9CZW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CZW4" } ] }, { "ec_number": "6.2.1.2", "activity": "a medium chain fatty acid + ATP + CoA = a medium-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q9CZW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CZW4" } ] }, { "ec_number": "6.2.1.15", "activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + ATP + CoA = (5Z,8Z,11Z,14Z)-eicosatetraenoyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "Q9CZW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CZW4" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }