{ "uniprot_canonical_ac": "Q497M6-1", "uniprot_ac": "Q497M6", "uniprot_id": "Q497M6_MOUSE", "mass": { "chemical_mass": 20048.0, "monoisotopic_mass": 20048.0 }, "refseq": { "ac": "NP_031560", "name": "B-cell leukemia/lymphoma 2 related protein A1b", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031560" }, "gene_names": [ { "name": "Bcl2a1b", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q497M6", "id": "Q497M6" }, { "name": "A1-b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031560", "id": "NP_031560" }, { "name": "Bcl2a1b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031560", "id": "NP_031560" } ], "protein_names": [ { "name": "B-cell leukemia/lymphoma 2 related protein A1b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031560", "id": "NP_031560" }, { "name": "B-cell leukemia/lymphoma 2 related protein A1b", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q497M6" }, { "name": "anti-apoptotic protein A1-b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031560", "id": "NP_031560" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q497M6", "url": "https://www.uniprot.org/uniprot/Q497M6" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Bcl2a1b", "url": "https://www.uniprot.org/uniprot/Q497M6", "locus": { "chromosome": "9", "start_pos": 89089880, "end_pos": 89081262, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000089929", "url": "https://www.ensembl.org/id/ENSMUSG00000089929" } ] } } ], "crossref": [ { "id": "ENSMUSG00000089929", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000089929", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd06845", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06845", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "12045", "url": "https://www.ncbi.nlm.nih.gov/gene/12045", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002475", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002475", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013282", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013282", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020717", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020717", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020726", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020726", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR026298", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026298", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036834", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036834", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046371", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046371", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:12045", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:12045", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1278326", "url": "http://www.informatics.jax.org/marker/MGI:1278326", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "NKAAWID", "url": "https://omabrowser.org/oma/group/NKAAWID/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4028889at2759", "url": "http://www.orthodb.org/?query=4028889at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11256", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11256", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11256:SF10", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11256:SF10", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00452", "url": "http://pfam.xfam.org/family/PF00452", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_031560", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_031560", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q497M6", "url": "https://www.uniprot.org/uniprot/Q497M6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q497M6-1", "url": "https://www.uniprot.org/uniprot/Q497M6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSKACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQMTGQFWEMLFLLK", "length": 172, "header": "tr|Q497M6-1|Q497M6_MOUSE Isoform 1 of B-cell leukemia/lymphoma 2 related protein A1b OS=Mus musculus OX=10090 GN=Bcl2a1b PE=2 SV=1 CANONICAL=Q497M6-1" }, "isoforms": [ { "isoform_ac": "Q497M6-1", "url": "", "sequence": { "sequence": "MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSKACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQMTGQFWEMLFLLK", "length": 172, "header": "tr|Q497M6-1|Q497M6_MOUSE Isoform 1 of B-cell leukemia/lymphoma 2 related protein A1b OS=Mus musculus OX=10090 GN=Bcl2a1b PE=2 SV=1 CANONICAL=Q497M6-1" }, "locus": { "chromosome": "9", "start_pos": 89089730, "end_pos": 89081413, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000068569.5", "url": "https://www.ensembl.org/id/ENSMUST00000068569.5" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000065612.5", "url": "https://www.ensembl.org/id/ENSMUSP00000065612.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "mmu:12045", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:12045", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q16548-1", "protein_name": "Bcl-2-related protein A1", "gene_name": "BCL2A1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC", "length": 175 }, "evidence": [ { "id": "45240451", "url": "http://www.informatics.jax.org/homology/45240451", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q497M6", "url": "https://www.uniprot.org/uniprot/Q497M6" } ], "pmid": "" }, { "name": "mitochondrial outer membrane", "id": "GO:0005741", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005741", "evidence": [ { "database": "UniProtKB", "id": "Q497M6", "url": "https://www.uniprot.org/uniprot/Q497M6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "Q497M6", "url": "https://www.uniprot.org/uniprot/Q497M6" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "Q497M6", "url": "https://www.uniprot.org/uniprot/Q497M6" } ], "pmid": "" }, { "name": "channel activity", "id": "GO:0015267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015267", "evidence": [ { "database": "UniProtKB", "id": "Q497M6", "url": "https://www.uniprot.org/uniprot/Q497M6" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "Q497M6", "url": "https://www.uniprot.org/uniprot/Q497M6" } ], "pmid": "" }, { "name": "BH domain binding", "id": "GO:0051400", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051400", "evidence": [ { "database": "UniProtKB", "id": "Q497M6", "url": "https://www.uniprot.org/uniprot/Q497M6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "Q497M6", "url": "https://www.uniprot.org/uniprot/Q497M6" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "Q497M6", "url": "https://www.uniprot.org/uniprot/Q497M6" } ], "pmid": "" }, { "name": "intrinsic apoptotic signaling pathway in response to DNA damage", "id": "GO:0008630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008630", "evidence": [ { "database": "UniProtKB", "id": "Q497M6", "url": "https://www.uniprot.org/uniprot/Q497M6" } ], "pmid": "" }, { "name": "release of cytochrome c from mitochondria", "id": "GO:0001836", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001836", "evidence": [ { "database": "UniProtKB", "id": "Q497M6", "url": "https://www.uniprot.org/uniprot/Q497M6" } ], "pmid": "" }, { "name": "mitochondrial fusion", "id": "GO:0008053", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008053", "evidence": [ { "database": "UniProtKB", "id": "Q497M6", "url": "https://www.uniprot.org/uniprot/Q497M6" } ], "pmid": "" }, { "name": "extrinsic apoptotic signaling pathway in absence of ligand", "id": "GO:0097192", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097192", "evidence": [ { "database": "UniProtKB", "id": "Q497M6", "url": "https://www.uniprot.org/uniprot/Q497M6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 128, "end_pos": 130, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }