{ "uniprot_canonical_ac": "Q45U48-1", "uniprot_ac": "Q45U48", "uniprot_id": "YG035_YEAST", "mass": { "chemical_mass": 8362.0, "monoisotopic_mass": 8362.0 }, "refseq": { "ac": "NP_878077", "name": "uncharacterized protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_878077" }, "gene_names": [], "protein_names": [ { "name": "Uncharacterized protein YGR035W-A", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q45U48" }, { "name": "uncharacterized protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_878077", "id": "NP_878077" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q45U48", "url": "https://www.uniprot.org/uniprot/Q45U48" } ], "common_name": "Yeast" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprot/Q45U48", "locus": {} } ], "crossref": [ { "id": "1466457", "url": "https://www.ncbi.nlm.nih.gov/gene/1466457", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "sce:YGR035W-A", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YGR035W-A", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "5525082at2759", "url": "http://www.orthodb.org/?query=5525082at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PR_Q45U48", "url": "http://purl.obolibrary.org/obo/PR_Q45U48", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_878077", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_878077", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000028827", "url": "https://www.yeastgenome.org/locus/S000028827", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q45U48", "url": "https://www.uniprot.org/uniprot/Q45U48", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q45U48-1", "url": "https://www.uniprot.org/uniprot/Q45U48-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLLYLYILYIALKTVSHLFFCNPCFRNLSVGDMLNPRLSLSFFTNHLLCPEAPLIIRGKGSYSAVGNFFSRKK", "length": 73, "header": "sp|Q45U48-1|YG035_YEAST Isoform 1 of Uncharacterized protein YGR035W-A OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=1 SV=1 CANONICAL=Q45U48-1" }, "isoforms": [ { "isoform_ac": "Q45U48-1", "url": "", "sequence": { "sequence": "MLLYLYILYIALKTVSHLFFCNPCFRNLSVGDMLNPRLSLSFFTNHLLCPEAPLIIRGKGSYSAVGNFFSRKK", "length": 73, "header": "sp|Q45U48-1|YG035_YEAST Isoform 1 of Uncharacterized protein YGR035W-A OS=Saccharomyces cerevisiae S288C OX=559292 GN= PE=1 SV=1 CANONICAL=Q45U48-1" }, "locus": { "chromosome": "VII", "start_pos": 557783, "end_pos": 557565, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "YGR035W-A_mRNA", "url": "https://www.ensembl.org/id/YGR035W-A_mRNA" }, { "database": "Ensembl Peptide", "id": "YGR035W-A", "url": "https://www.ensembl.org/id/YGR035W-A" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Parallel identification of new genes in Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2002", "authors": "Washburn M.P., Yates J.R. III, Lockhart D.J., Oshiro G., Winzeler E.A., Wodicka L.M.", "evidence": [ { "database": "UniProtKB", "id": "Q45U48", "url": "https://www.uniprot.org/uniprot/Q45U48" } ], "reference": [ { "type": "PubMed", "id": "12176929", "url": "https://glygen.org/publication/PubMed/12176929" } ] }, { "title": "Quantitative trait loci mapped to single-nucleotide resolution in yeast.", "journal": "Nat. Genet.", "date": "2005", "authors": "Deutschbauer Adam M, Davis Ronald W", "evidence": [ { "database": "UniProtKB", "id": "Q45U48", "url": "https://www.uniprot.org/uniprot/Q45U48" } ], "reference": [ { "type": "PubMed", "id": "16273108", "url": "https://glygen.org/publication/PubMed/16273108" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q45U48", "url": "https://www.uniprot.org/uniprot/Q45U48" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII.", "journal": "Nature", "date": "1997", "authors": "Mewes H.-W., Minenkova O., Schaefer M., Scharfe M., Wambutt R., Wedler H., Verhasselt P., Hansen M., Rose M., Durand P., Brueckner M., Plevani P., Netter P., Rieger M., Zimmermann M., Portetelle D., Wolf K., Bertani I., Delius H., Kleine K., Portillo F., Hofmann B., Albers M., Schaefer B., Kramer W., Castagnoli L., Volckaert G., Koetter P., Entian K.-D., Kramer B., Rinaldi T., Thierry A., Louis E.J., Vandenbol M., Martegani E., Robben J., Nombela C., Vanoni M., Arroyo J., Eraso P., Mazon M.J., James C.M., Carignani G., Dujon B., Feuermann M., Goffeau A., Hani J., Hilger F., Klima R., Mueller-Auer S., Oliver S.G., Potier S., Rodrigues-Pousada C., Schmidheini T., Souciet J.-L., Steensma H.Y., Zollner A., Bruschi C.V., Escribano V., Frontali L., Guerreiro P., Mazzoni C., Purnelle B., Rodriguez-Torres A.M., Skala J., Talla E., Voet M., de Wergifosse P., Agostoni-Carbone M.L., Albermann K., Backes U., Barreiros T., Bjourson A.J., Cerdan E., Clemente M.L., Coblenz A., Coglievina M., Coissac E., Defoor E., Del Bino S., Delneri D., Fabiani L., Fartmann B., Feroli F., Garcia-Gonzalez M., Garcia-Saez M.I., Hebling U., Hernandez K., Heumann K., Indge K.J., Lauquin G., Leuther H., Maillier E., Marconi A., McReynolds A.D.K., Melchioretto P., Nawrocki A., Neu R., Panzeri L., Paoluzi S., Riles L., Rodriguez-Belmonte E., Ruzzi M., Saliola M., Sanchez-Perez M., Schreer A., Tettelin H., Van Dyck L., Watson M.D., Weber N., Wedler E., Wipfli P., Wright L.F., Zaccaria P., van der Aart Q.J.M.", "evidence": [ { "database": "UniProtKB", "id": "Q45U48", "url": "https://www.uniprot.org/uniprot/Q45U48" } ], "reference": [ { "type": "PubMed", "id": "9169869", "url": "https://glygen.org/publication/PubMed/9169869" } ] } ], "pathway": [ { "id": "sce:YGR035W-A", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YGR035W-A", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [ { "start_pos": 27, "end_pos": 29, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }