{ "uniprot_canonical_ac": "Q3UD01-1", "uniprot_ac": "Q3UD01", "uniprot_id": "A7L3B_MOUSE", "mass": { "chemical_mass": 10731.0, "monoisotopic_mass": 10731.0 }, "refseq": {}, "gene_names": [ { "name": "Atxn7l3b", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q3UD01", "id": "Q3UD01" } ], "protein_names": [ { "name": "Ataxin-7-like protein 3B", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q3UD01" } ], "function": [ { "annotation": "By binding to ENY2, interferes with the nuclear functions of the deubiquitinase (DUB) module of the SAGA complex which consists of ENY2, ATXN7, ATXN7L3 and the histone deubiquitinating component USP22. Affects USP22 DUB activity toward histones indirectly by changing the subcellular distribution of ENY2 and altering ENY2 availability for ATXN7L3 interaction. Regulates H2B monoubiquitination (H2Bub1) levels through cytoplasmic sequestration of ENY2 resulting in loss of nuclear ENY2-ATXN7L3 association which destabilizes ATXN7L3. Affects protein expression levels of ENY2 and ATXN7L3.", "evidence": [ { "database": "UniProtKB", "id": "Q3UD01", "url": "https://www.uniprot.org/uniprot/Q3UD01#function" }, { "database": "UniProtKB", "id": "Q96GX2", "url": "https://www.uniprot.org/uniprot/Q96GX2#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3UD01", "url": "https://www.uniprot.org/uniprot/Q3UD01" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Atxn7l3b", "url": "https://www.uniprot.org/uniprot/Q3UD01", "locus": { "chromosome": "10", "start_pos": 112761335, "end_pos": 112764906, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000074748", "url": "https://www.ensembl.org/id/ENSMUSG00000074748" } ] } } ], "crossref": [ { "id": "ENSMUSG00000074748", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000074748", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "10127", "url": "https://glyconnect.expasy.org/browser/proteins/10127", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "10993", "url": "https://glyconnect.expasy.org/browser/proteins/10993", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11", "url": "https://glyconnect.expasy.org/browser/proteins/11", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11040", "url": "https://glyconnect.expasy.org/browser/proteins/11040", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11468", "url": "https://glyconnect.expasy.org/browser/proteins/11468", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11470", "url": "https://glyconnect.expasy.org/browser/proteins/11470", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11471", "url": "https://glyconnect.expasy.org/browser/proteins/11471", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11483", "url": "https://glyconnect.expasy.org/browser/proteins/11483", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11487", "url": "https://glyconnect.expasy.org/browser/proteins/11487", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11489", "url": "https://glyconnect.expasy.org/browser/proteins/11489", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11493", "url": "https://glyconnect.expasy.org/browser/proteins/11493", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11499", "url": "https://glyconnect.expasy.org/browser/proteins/11499", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11505", "url": "https://glyconnect.expasy.org/browser/proteins/11505", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11506", "url": "https://glyconnect.expasy.org/browser/proteins/11506", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11510", "url": "https://glyconnect.expasy.org/browser/proteins/11510", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11519", "url": "https://glyconnect.expasy.org/browser/proteins/11519", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11521", "url": "https://glyconnect.expasy.org/browser/proteins/11521", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11526", "url": "https://glyconnect.expasy.org/browser/proteins/11526", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11527", "url": "https://glyconnect.expasy.org/browser/proteins/11527", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11530", "url": "https://glyconnect.expasy.org/browser/proteins/11530", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11532", "url": "https://glyconnect.expasy.org/browser/proteins/11532", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11533", "url": "https://glyconnect.expasy.org/browser/proteins/11533", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11534", "url": "https://glyconnect.expasy.org/browser/proteins/11534", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11553", "url": "https://glyconnect.expasy.org/browser/proteins/11553", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11557", "url": "https://glyconnect.expasy.org/browser/proteins/11557", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11560", "url": "https://glyconnect.expasy.org/browser/proteins/11560", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11569", "url": "https://glyconnect.expasy.org/browser/proteins/11569", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11576", "url": "https://glyconnect.expasy.org/browser/proteins/11576", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11580", "url": "https://glyconnect.expasy.org/browser/proteins/11580", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11581", "url": "https://glyconnect.expasy.org/browser/proteins/11581", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11597", "url": "https://glyconnect.expasy.org/browser/proteins/11597", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11604", "url": "https://glyconnect.expasy.org/browser/proteins/11604", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11617", "url": "https://glyconnect.expasy.org/browser/proteins/11617", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11626", "url": "https://glyconnect.expasy.org/browser/proteins/11626", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11629", "url": "https://glyconnect.expasy.org/browser/proteins/11629", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11632", "url": "https://glyconnect.expasy.org/browser/proteins/11632", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11643", "url": "https://glyconnect.expasy.org/browser/proteins/11643", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11649", "url": "https://glyconnect.expasy.org/browser/proteins/11649", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11655", "url": "https://glyconnect.expasy.org/browser/proteins/11655", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11657", "url": "https://glyconnect.expasy.org/browser/proteins/11657", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11681", "url": "https://glyconnect.expasy.org/browser/proteins/11681", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11691", "url": "https://glyconnect.expasy.org/browser/proteins/11691", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11692", "url": "https://glyconnect.expasy.org/browser/proteins/11692", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11696", "url": "https://glyconnect.expasy.org/browser/proteins/11696", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11704", "url": "https://glyconnect.expasy.org/browser/proteins/11704", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11707", "url": "https://glyconnect.expasy.org/browser/proteins/11707", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11714", "url": "https://glyconnect.expasy.org/browser/proteins/11714", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11720", "url": "https://glyconnect.expasy.org/browser/proteins/11720", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11739", "url": "https://glyconnect.expasy.org/browser/proteins/11739", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11741", "url": "https://glyconnect.expasy.org/browser/proteins/11741", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11746", "url": "https://glyconnect.expasy.org/browser/proteins/11746", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11757", "url": "https://glyconnect.expasy.org/browser/proteins/11757", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11777", "url": "https://glyconnect.expasy.org/browser/proteins/11777", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11785", "url": "https://glyconnect.expasy.org/browser/proteins/11785", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11793", "url": "https://glyconnect.expasy.org/browser/proteins/11793", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11798", "url": "https://glyconnect.expasy.org/browser/proteins/11798", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11802", "url": "https://glyconnect.expasy.org/browser/proteins/11802", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11807", "url": "https://glyconnect.expasy.org/browser/proteins/11807", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11813", "url": "https://glyconnect.expasy.org/browser/proteins/11813", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11817", "url": "https://glyconnect.expasy.org/browser/proteins/11817", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11819", "url": "https://glyconnect.expasy.org/browser/proteins/11819", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11820", "url": "https://glyconnect.expasy.org/browser/proteins/11820", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11830", "url": "https://glyconnect.expasy.org/browser/proteins/11830", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11840", "url": "https://glyconnect.expasy.org/browser/proteins/11840", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11842", "url": "https://glyconnect.expasy.org/browser/proteins/11842", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11843", "url": "https://glyconnect.expasy.org/browser/proteins/11843", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11847", "url": "https://glyconnect.expasy.org/browser/proteins/11847", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "1185", "url": "https://glyconnect.expasy.org/browser/proteins/1185", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11854", "url": "https://glyconnect.expasy.org/browser/proteins/11854", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11863", "url": "https://glyconnect.expasy.org/browser/proteins/11863", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11865", "url": "https://glyconnect.expasy.org/browser/proteins/11865", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11866", "url": "https://glyconnect.expasy.org/browser/proteins/11866", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11875", "url": "https://glyconnect.expasy.org/browser/proteins/11875", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11882", "url": "https://glyconnect.expasy.org/browser/proteins/11882", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11885", "url": "https://glyconnect.expasy.org/browser/proteins/11885", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11897", "url": "https://glyconnect.expasy.org/browser/proteins/11897", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11908", "url": "https://glyconnect.expasy.org/browser/proteins/11908", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11909", "url": "https://glyconnect.expasy.org/browser/proteins/11909", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11910", "url": "https://glyconnect.expasy.org/browser/proteins/11910", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11918", "url": "https://glyconnect.expasy.org/browser/proteins/11918", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11929", "url": "https://glyconnect.expasy.org/browser/proteins/11929", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11932", "url": "https://glyconnect.expasy.org/browser/proteins/11932", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11936", "url": "https://glyconnect.expasy.org/browser/proteins/11936", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11943", "url": "https://glyconnect.expasy.org/browser/proteins/11943", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11950", "url": "https://glyconnect.expasy.org/browser/proteins/11950", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11951", "url": "https://glyconnect.expasy.org/browser/proteins/11951", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11965", "url": "https://glyconnect.expasy.org/browser/proteins/11965", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11967", "url": "https://glyconnect.expasy.org/browser/proteins/11967", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "11970", "url": "https://glyconnect.expasy.org/browser/proteins/11970", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "130", "url": "https://glyconnect.expasy.org/browser/proteins/130", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "1443", "url": "https://glyconnect.expasy.org/browser/proteins/1443", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "1555", "url": "https://glyconnect.expasy.org/browser/proteins/1555", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "156", "url": "https://glyconnect.expasy.org/browser/proteins/156", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "1642", "url": "https://glyconnect.expasy.org/browser/proteins/1642", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "181", "url": "https://glyconnect.expasy.org/browser/proteins/181", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "1822", "url": "https://glyconnect.expasy.org/browser/proteins/1822", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "2007", "url": "https://glyconnect.expasy.org/browser/proteins/2007", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "2039", "url": "https://glyconnect.expasy.org/browser/proteins/2039", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "2138", "url": "https://glyconnect.expasy.org/browser/proteins/2138", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "223", "url": "https://glyconnect.expasy.org/browser/proteins/223", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "2277", "url": "https://glyconnect.expasy.org/browser/proteins/2277", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "2324", "url": "https://glyconnect.expasy.org/browser/proteins/2324", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "235", "url": "https://glyconnect.expasy.org/browser/proteins/235", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "2376", "url": "https://glyconnect.expasy.org/browser/proteins/2376", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "256", "url": "https://glyconnect.expasy.org/browser/proteins/256", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "258", "url": "https://glyconnect.expasy.org/browser/proteins/258", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "2586", "url": "https://glyconnect.expasy.org/browser/proteins/2586", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "260", "url": "https://glyconnect.expasy.org/browser/proteins/260", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "2641", "url": "https://glyconnect.expasy.org/browser/proteins/2641", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "2884", "url": "https://glyconnect.expasy.org/browser/proteins/2884", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "2947", "url": "https://glyconnect.expasy.org/browser/proteins/2947", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "295", "url": "https://glyconnect.expasy.org/browser/proteins/295", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "3017", "url": "https://glyconnect.expasy.org/browser/proteins/3017", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "3170", "url": "https://glyconnect.expasy.org/browser/proteins/3170", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "3177", "url": "https://glyconnect.expasy.org/browser/proteins/3177", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "3208", "url": "https://glyconnect.expasy.org/browser/proteins/3208", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "321", "url": "https://glyconnect.expasy.org/browser/proteins/321", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "3247", "url": "https://glyconnect.expasy.org/browser/proteins/3247", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "3318", "url": "https://glyconnect.expasy.org/browser/proteins/3318", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "3484", "url": "https://glyconnect.expasy.org/browser/proteins/3484", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "3517", "url": "https://glyconnect.expasy.org/browser/proteins/3517", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "362", "url": "https://glyconnect.expasy.org/browser/proteins/362", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "370", "url": "https://glyconnect.expasy.org/browser/proteins/370", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "379", "url": "https://glyconnect.expasy.org/browser/proteins/379", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "412", "url": "https://glyconnect.expasy.org/browser/proteins/412", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "430", "url": "https://glyconnect.expasy.org/browser/proteins/430", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "437", "url": "https://glyconnect.expasy.org/browser/proteins/437", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "473", "url": "https://glyconnect.expasy.org/browser/proteins/473", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "511", "url": "https://glyconnect.expasy.org/browser/proteins/511", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "559", "url": "https://glyconnect.expasy.org/browser/proteins/559", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "575", "url": "https://glyconnect.expasy.org/browser/proteins/575", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "750", "url": "https://glyconnect.expasy.org/browser/proteins/750", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "824", "url": "https://glyconnect.expasy.org/browser/proteins/824", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "862", "url": "https://glyconnect.expasy.org/browser/proteins/862", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "863", "url": "https://glyconnect.expasy.org/browser/proteins/863", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "864", "url": "https://glyconnect.expasy.org/browser/proteins/864", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "865", "url": "https://glyconnect.expasy.org/browser/proteins/865", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "866", "url": "https://glyconnect.expasy.org/browser/proteins/866", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "867", "url": "https://glyconnect.expasy.org/browser/proteins/867", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "885", "url": "https://glyconnect.expasy.org/browser/proteins/885", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "888", "url": "https://glyconnect.expasy.org/browser/proteins/888", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "909", "url": "https://glyconnect.expasy.org/browser/proteins/909", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "910", "url": "https://glyconnect.expasy.org/browser/proteins/910", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "911", "url": "https://glyconnect.expasy.org/browser/proteins/911", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "923", "url": "https://glyconnect.expasy.org/browser/proteins/923", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "938", "url": "https://glyconnect.expasy.org/browser/proteins/938", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "939", "url": "https://glyconnect.expasy.org/browser/proteins/939", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "940", "url": "https://glyconnect.expasy.org/browser/proteins/940", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "941", "url": "https://glyconnect.expasy.org/browser/proteins/941", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "944", "url": "https://glyconnect.expasy.org/browser/proteins/944", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "952", "url": "https://glyconnect.expasy.org/browser/proteins/952", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "9631", "url": "https://glyconnect.expasy.org/browser/proteins/9631", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "9637", "url": "https://glyconnect.expasy.org/browser/proteins/9637", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "9710", "url": "https://glyconnect.expasy.org/browser/proteins/9710", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "978", "url": "https://glyconnect.expasy.org/browser/proteins/978", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "9886", "url": "https://glyconnect.expasy.org/browser/proteins/9886", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "IPR042933", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042933", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:382423", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:382423", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1914971", "url": "http://www.informatics.jax.org/marker/MGI:1914971", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "GPDQELQ", "url": "https://omabrowser.org/oma/group/GPDQELQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5404108at2759", "url": "http://www.orthodb.org/?query=5404108at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR47733", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47733", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47733:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47733:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PR_Q3UD01", "url": "http://purl.obolibrary.org/obo/PR_Q3UD01", "database": "PRO", "categories": [ "Protein" ] }, { "id": "Q3UD01", "url": "https://www.uniprot.org/uniprot/Q3UD01", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3UD01-1", "url": "https://www.uniprot.org/uniprot/Q3UD01-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEEISLANLDTNKLEAIAQEIYVDLIEDSCLGFCFEVHRAVKCGYFYLEFADTGSVKDFGIQPVEDKGACRLPLCSLPGDPGDGPQTELQRSPPEFQ", "length": 97, "header": "sp|Q3UD01-1|A7L3B_MOUSE Isoform 1 of Ataxin-7-like protein 3B OS=Mus musculus OX=10090 GN=Atxn7l3b PE=1 SV=1 CANONICAL=Q3UD01-1" }, "isoforms": [ { "isoform_ac": "Q3UD01-1", "url": "", "sequence": { "sequence": "MEEISLANLDTNKLEAIAQEIYVDLIEDSCLGFCFEVHRAVKCGYFYLEFADTGSVKDFGIQPVEDKGACRLPLCSLPGDPGDGPQTELQRSPPEFQ", "length": 97, "header": "sp|Q3UD01-1|A7L3B_MOUSE Isoform 1 of Ataxin-7-like protein 3B OS=Mus musculus OX=10090 GN=Atxn7l3b PE=1 SV=1 CANONICAL=Q3UD01-1" }, "locus": { "chromosome": "10", "start_pos": 112764627, "end_pos": 112764337, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000099276", "url": "https://www.ensembl.org/id/ENSMUST00000099276" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000096882", "url": "https://www.ensembl.org/id/ENSMUSP00000096882" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 92, "end_pos": 92, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q3UD01", "url": "https://www.uniprot.org/uniprot/Q3UD01" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q3UD01", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q3UD01" } ], "site_lbl": "Ser92" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Genome-wide survey for biologically functional pseudogenes.", "journal": "PLoS Comput. Biol.", "date": "2006", "authors": "Arvestad L., Lagergren J., Svensson O.", "evidence": [ { "database": "UniProtKB", "id": "Q3UD01", "url": "https://www.uniprot.org/uniprot/Q3UD01" } ], "reference": [ { "type": "PubMed", "id": "16680195", "url": "https://glygen.org/publication/PubMed/16680195" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q3UD01", "url": "https://www.uniprot.org/uniprot/Q3UD01" }, { "database": "iPTMnet", "id": "Q3UD01", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q3UD01" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] } ], "pathway": [ { "id": "mmu:382423", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:382423", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q96GX2-1", "protein_name": "Ataxin-7-like protein 3B", "gene_name": "ATXN7L3B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEEISLANLDTNKLEAIAQEIYVDLIEDSCLGFCFEVHRAVKCGYFYLEFAETGSVKDFGIQPVEDKGACRLPLCSLPGEPGNGPDQQLQRSPPEFQ", "length": 97 }, "evidence": [ { "id": "Q3UD01", "url": "https://omabrowser.org/oma/group/Q3UD01/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q3UD01", "url": "https://www.uniprot.org/uniprot/Q3UD01" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "regulation of gene expression", "id": "GO:0010468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010468", "evidence": [ { "database": "UniProtKB", "id": "Q3UD01", "url": "https://www.uniprot.org/uniprot/Q3UD01" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "glycoprotein", "definition": "A protein that contains at least one glycosylated residue. [PRO:DAN]", "evidence": [ { "id": "PR:000037069", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000037069" } ] } ], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }