{ "uniprot_canonical_ac": "Q3U5F4-1", "uniprot_ac": "Q3U5F4", "uniprot_id": "YRDC_MOUSE", "mass": { "chemical_mass": 29454.0, "monoisotopic_mass": 29454.0 }, "refseq": { "ac": "NP_705794", "name": "threonylcarbamoyl-AMP synthase precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705794" }, "gene_names": [ { "name": "Yrdc", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q3U5F4", "id": "Q3U5F4" }, { "name": "IRIP; ITIP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705794", "id": "NP_705794" }, { "name": "Irip", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q3U5F4", "id": "Q3U5F4" }, { "name": "Yrdc", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705794", "id": "NP_705794" } ], "protein_names": [ { "name": "Threonylcarbamoyl-AMP synthase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q3U5F4" }, { "name": "2.7.7.87", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q3U5F4" }, { "name": "Ischemia/reperfusion-inducible protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q3U5F4" }, { "name": "mIRIP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q3U5F4" }, { "name": "threonylcarbamoyl-AMP synthase precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705794", "id": "NP_705794" }, { "name": "yrdC domain-containing protein, mitochondrial; Ischemia/reperfusion-inducible protein; mIRIP; threonylcarbamoyl-AMP synthase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705794", "id": "NP_705794" } ], "function": [ { "annotation": "Cytoplasmic and mitochondrial threonylcarbamoyl-AMP synthase required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Catalyzes the conversion of L-threonine, HCO(3)(-)/CO(2) and ATP to give threonylcarbamoyl-AMP (TC-AMP) as the acyladenylate intermediate, with the release of diphosphate. Participates in t(6)A37 formation in cytoplasmic and mitochondrial tRNAs (By similarity). May regulate the activity of some transporters (PubMed:16024787).", "evidence": [ { "database": "UniProtKB", "id": "Q3U5F4", "url": "https://www.uniprot.org/uniprot/Q3U5F4#function" }, { "database": "UniProtKB", "id": "Q86U90", "url": "https://www.uniprot.org/uniprot/Q86U90#function" }, { "database": "PubMed", "id": "16024787", "url": "https://glygen.org/publication/PubMed/16024787" } ] } ], "disease": [ { "disease_id": "DOID:0080694", "recommended_name": { "id": "DOID:0080694", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080694", "name": "Galloway-Mowat syndrome", "description": "A syndrome that is characterized by developmental delay, progressive microcephaly, cerebral and cerebellar atrophy with extrapyramidal involvement, and optic atrophy." }, "synonyms": [ { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "Galloway-Mowat syndrome 1", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "Galloway-Mowat syndrome 1", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "GAMOS1", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "Galloway syndrome", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "cerebellar ataxia with intellectual disability, optic atrophy, and skin abnormalities", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "cerebellar ataxia with mental retardation, optic atrophy, and skin abnormalities", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "microcephaly, hiatal hernia, and nephrotic syndrome", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "nephrosis-microcephaly syndrome", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "nephrosis-neuronal dysmigration syndrome", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "spinocerebellar ataxia, autosomal recessive 5", "description": "" }, { "id": "MONDO:0033005", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033005", "name": "spinocerebellar ataxia, autosomal recessive 5, formerly", "description": "" }, { "id": "MIM:251300", "resource": "MIM", "url": "https://www.omim.org/entry/251300", "name": "Galloway-Mowat syndrome 1", "description": "Galloway-Mowat syndrome 1" } ], "evidence": [ { "id": "0080694", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080694" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3U5F4", "url": "https://www.uniprot.org/uniprot/Q3U5F4" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Yrdc", "url": "https://www.uniprot.org/uniprot/Q3U5F4", "locus": { "chromosome": "4", "start_pos": 124749035, "end_pos": 124744472, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000028889", "url": "https://www.ensembl.org/id/ENSMUSG00000028889" } ] } } ], "crossref": [ { "id": "ENSMUSG00000028889", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000028889", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "230734", "url": "https://www.ncbi.nlm.nih.gov/gene/230734", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR006070", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006070", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017945", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017945", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:230734", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:230734", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2387201", "url": "http://www.informatics.jax.org/marker/MGI:2387201", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q3U5F4", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q3U5F4", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "RDLCAVW", "url": "https://omabrowser.org/oma/group/RDLCAVW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5488554at2759", "url": "http://www.orthodb.org/?query=5488554at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR17490", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR17490", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR17490:SF10", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR17490:SF10", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01300", "url": "http://pfam.xfam.org/family/PF01300", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q3U5F4", "url": "http://purl.obolibrary.org/obo/PR_Q3U5F4", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_705794", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_705794", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "36407", "url": "https://www.rhea-db.org/rhea/36407", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "G8JL83", "url": "https://www.uniprot.org/uniprot/G8JL83", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G8JL83-1", "url": "https://www.uniprot.org/uniprot/G8JL83-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3U5F4", "url": "https://www.uniprot.org/uniprot/Q3U5F4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3U5F4-1", "url": "https://www.uniprot.org/uniprot/Q3U5F4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSTARPCAGLRAAVAAGMGLSDGPASSGRGCRLLRPPEPAPALPGARLLRLPESEPVEAASPERSGWTEALRAAVAELRAGAVVAVPTDTLYGLACSASSSAALSCVYRLKGRSEAKPLAVCLGRVADVYRYCQVRVPRELLEDLFPGPVTLVMERSEELNKDLNPFTRLVGIRIPDHAFMLDLAQMFGGPLALTSANLSSQASSLSVEEFQDLWPHLSLVIDGGPIGDSQSPECRLGSTVVDLSVPGKFGIIRPGCALENTTSILQQKYGLLPSQGSCS", "length": 280, "header": "sp|Q3U5F4-1|YRDC_MOUSE Isoform 1 of Threonylcarbamoyl-AMP synthase OS=Mus musculus OX=10090 GN=Yrdc PE=1 SV=1 CANONICAL=Q3U5F4-1" }, "isoforms": [ { "isoform_ac": "G8JL83-1", "url": "", "sequence": { "sequence": "MERSEELNKDLNPFTRLVGIRIPDHAFMLDLAQMFGGPLALTSANLSSQASSLSVEEFQDLWPHLSLVIDGGPIGDSQSPECRLGSTVVDLSVPGKFGIIRPGCA", "length": 105, "header": "tr|G8JL83-1|YRDC_MOUSE Computationally mapped isoform of Threonylcarbamoyl-AMP synthase OS=Mus musculus OX=10090 GN=Yrdc PE=1 SV=1 CANONICAL=Q3U5F4-1" }, "locus": { "chromosome": "4", "start_pos": 124748271, "end_pos": 124745553, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000144851.3", "url": "https://www.ensembl.org/id/ENSMUST00000144851.3" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000114150.3", "url": "https://www.ensembl.org/id/ENSMUSP00000114150.3" } ] } }, { "isoform_ac": "Q3U5F4-1", "url": "", "sequence": { "sequence": "MSTARPCAGLRAAVAAGMGLSDGPASSGRGCRLLRPPEPAPALPGARLLRLPESEPVEAASPERSGWTEALRAAVAELRAGAVVAVPTDTLYGLACSASSSAALSCVYRLKGRSEAKPLAVCLGRVADVYRYCQVRVPRELLEDLFPGPVTLVMERSEELNKDLNPFTRLVGIRIPDHAFMLDLAQMFGGPLALTSANLSSQASSLSVEEFQDLWPHLSLVIDGGPIGDSQSPECRLGSTVVDLSVPGKFGIIRPGCALENTTSILQQKYGLLPSQGSCS", "length": 280, "header": "sp|Q3U5F4-1|YRDC_MOUSE Isoform 1 of Threonylcarbamoyl-AMP synthase OS=Mus musculus OX=10090 GN=Yrdc PE=1 SV=1 CANONICAL=Q3U5F4-1" }, "locus": { "chromosome": "4", "start_pos": 124748337, "end_pos": 124744568, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000102628", "url": "https://www.ensembl.org/id/ENSMUST00000102628" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000099688", "url": "https://www.ensembl.org/id/ENSMUSP00000099688" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q3U5F4", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q3U5F4" }, { "id": "25153642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25153642" } ] } ], "phosphorylation": [ { "start_pos": 61, "end_pos": 61, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q3U5F4", "url": "https://www.uniprot.org/uniprot/Q3U5F4" } ], "site_lbl": "Ser61" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "IRIP, a new ischemia/reperfusion-inducible protein that participates in the regulation of transporter activity.", "journal": "Mol. Cell. Biol.", "date": "2005", "authors": "Jiang W, Prokopenko O, Wong L, Inouye M, Mirochnitchenko O", "evidence": [ { "database": "UniProtKB", "id": "Q3U5F4", "url": "https://www.uniprot.org/uniprot/Q3U5F4" } ], "reference": [ { "type": "PubMed", "id": "16024787", "url": "https://glygen.org/publication/PubMed/16024787" } ] }, { "title": "Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.", "journal": "Mol. Cell. Proteomics", "date": "2014", "authors": "Guo A, Gu H, Zhou J, Mulhern D, Wang Y, Lee KA, Yang V, Aguiar M, Kornhauser J, Jia X, Ren J, Beausoleil SA, Silva JC, Vemulapalli V, Bedford MT, Comb MJ", "evidence": [ { "database": "UniProtKB", "id": "Q3U5F4", "url": "https://www.uniprot.org/uniprot/Q3U5F4" } ], "reference": [ { "type": "PubMed", "id": "24129315", "url": "https://glygen.org/publication/PubMed/24129315" } ] }, { "title": "Changes in metabolic chemical reporter structure yield a selective probe of O-GlcNAc modification.", "journal": "Journal of the American Chemical Society", "date": "2014", "authors": "Chuh KN, Zaro BW, Piller F, Piller V, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q3U5F4", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q3U5F4" } ], "reference": [ { "type": "PubMed", "id": "25153642", "url": "https://glygen.org/publication/PubMed/25153642" } ] } ], "pathway": [ { "id": "mmu:230734", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:230734", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q499R4-1", "protein_name": "Threonylcarbamoyl-AMP synthase", "gene_name": "Yrdc", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSTARPCAGLRAAVAAGMGLSDGPAGSSRGCRLLRPPAPAPALPGARLLRLPESEAVEAASPERSGWTEALRAAVAELRAGAVVAVPTDTLYGLACSASCSAALSCVYRLKGRSEAKPLAVCLGRVADVYRYCQVRVPRELLEDLFPGPVTLVMERSEELNKDLNPFTPLVGIRIPDHAFMLDLAQMFGGPLALTSANLSSQASSLSVEEFQDLWPHLSLVIDGGPIGDSESPECRLGSTVVDLSVPGKFGIIRSGCALENTTAILQGKYGLLPSQGSCS", "length": 280 }, "evidence": [ { "id": "45238527", "url": "http://www.informatics.jax.org/homology/45238527", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q86U90-1", "protein_name": "Threonylcarbamoyl-AMP synthase", "gene_name": "YRDC", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSPARRCRGMRAAVAASVGLSEGPAGSRSGRLFRPPSPAPAAPGARLLRLPGSGAVQAASPERAGWTEALRAAVAELRAGAVVAVPTDTLYGLACAASCSAALRAVYRLKGRSEAKPLAVCLGRVADVYRYCRVRVPEGLLKDLLPGPVTLVMERSEELNKDLNPFTPLVGIRIPDHAFMQDLAQMFEGPLALTSANLSSQASSLNVEEFQDLWPQLSLVIDGGQIGDGQSPECRLGSTVVDLSVPGKFGIIRPGCALESTTAILQQKYGLLPSHASYL", "length": 279 }, "evidence": [ { "id": "45238527", "url": "http://www.informatics.jax.org/homology/45238527", "database": "MGI" }, { "id": "Q3U5F4", "url": "https://omabrowser.org/oma/group/Q3U5F4/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "double-stranded RNA binding", "id": "GO:0003725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003725", "evidence": [ { "database": "UniProtKB", "id": "Q3U5F4", "url": "https://www.uniprot.org/uniprot/Q3U5F4" } ], "pmid": "" }, { "name": "tRNA binding", "id": "GO:0000049", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000049", "evidence": [ { "database": "UniProtKB", "id": "Q3U5F4", "url": "https://www.uniprot.org/uniprot/Q3U5F4" } ], "pmid": "" }, { "name": "nucleotidyltransferase activity", "id": "GO:0016779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016779", "evidence": [ { "database": "UniProtKB", "id": "Q3U5F4", "url": "https://www.uniprot.org/uniprot/Q3U5F4" } ], "pmid": "" }, { "name": "L-threonylcarbamoyladenylate synthase", "id": "GO:0061710", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061710", "evidence": [ { "database": "UniProtKB", "id": "Q3U5F4", "url": "https://www.uniprot.org/uniprot/Q3U5F4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q3U5F4", "url": "https://www.uniprot.org/uniprot/Q3U5F4" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q3U5F4", "url": "https://www.uniprot.org/uniprot/Q3U5F4" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q3U5F4", "url": "https://www.uniprot.org/uniprot/Q3U5F4" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q3U5F4", "url": "https://www.uniprot.org/uniprot/Q3U5F4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "tRNA threonylcarbamoyladenosine modification", "id": "GO:0002949", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002949", "evidence": [ { "database": "UniProtKB", "id": "Q3U5F4", "url": "https://www.uniprot.org/uniprot/Q3U5F4" } ], "pmid": "" }, { "name": "negative regulation of transport", "id": "GO:0051051", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051051", "evidence": [ { "database": "UniProtKB", "id": "Q3U5F4", "url": "https://www.uniprot.org/uniprot/Q3U5F4" } ], "pmid": "" }, { "name": "regulation of translational fidelity", "id": "GO:0006450", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006450", "evidence": [ { "database": "UniProtKB", "id": "Q3U5F4", "url": "https://www.uniprot.org/uniprot/Q3U5F4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 198, "end_pos": 200, "annotation": "n_glycosylation_sequon" }, { "start_pos": 261, "end_pos": 263, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "36407", "name": "", "equation": "ATP + hydrogencarbonate + L-threonine = diphosphate + H2O + L-threonylcarbamoyladenylate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q499R4-1", "Q86U90-1", "Q3U5F4-1", "P32579-1", "Q54XJ3-1", "Q8SYJ9-1" ], "evidence": [ { "id": "36407", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/36407" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P32579", "gene_name": "SUA5", "activity": [ { "ec_number": "2.7.7.87", "activity": "ATP + hydrogencarbonate + L-threonine = diphosphate + H2O + L-threonylcarbamoyladenylate.", "evidence": [ { "id": "P32579", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32579" } ] }, { "ec_number": "2.7.7.87", "activity": "", "evidence": [ { "id": "P32579", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32579" } ] } ] }, { "uniprot_ac": "Q3U5F4", "gene_name": "Yrdc", "activity": [ { "ec_number": "2.7.7.87", "activity": "ATP + hydrogencarbonate + L-threonine = diphosphate + H2O + L-threonylcarbamoyladenylate.", "evidence": [ { "id": "Q3U5F4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U5F4" } ] }, { "ec_number": "2.7.7.87", "activity": "", "evidence": [ { "id": "Q3U5F4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U5F4" } ] } ] }, { "uniprot_ac": "Q499R4", "gene_name": "Yrdc", "activity": [ { "ec_number": "2.7.7.87", "activity": "ATP + hydrogencarbonate + L-threonine = diphosphate + H2O + L-threonylcarbamoyladenylate.", "evidence": [ { "id": "Q499R4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q499R4" } ] }, { "ec_number": "2.7.7.87", "activity": "", "evidence": [ { "id": "Q499R4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q499R4" } ] } ] }, { "uniprot_ac": "Q54XJ3", "gene_name": "", "activity": [ { "ec_number": "2.7.7.87", "activity": "ATP + hydrogencarbonate + L-threonine = diphosphate + H2O + L-threonylcarbamoyladenylate.", "evidence": [ { "id": "Q54XJ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XJ3" } ] }, { "ec_number": "2.7.7.87", "activity": "", "evidence": [ { "id": "Q54XJ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54XJ3" } ] } ] }, { "uniprot_ac": "Q86U90", "gene_name": "YRDC", "activity": [ { "ec_number": "2.7.7.87", "activity": "ATP + hydrogencarbonate + L-threonine = diphosphate + H2O + L-threonylcarbamoyladenylate.", "evidence": [ { "id": "Q86U90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86U90" } ] }, { "ec_number": "2.7.7.87", "activity": "", "evidence": [ { "id": "Q86U90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86U90" } ] } ] }, { "uniprot_ac": "Q8SYJ9", "gene_name": "Tcs1", "activity": [ { "ec_number": "2.7.7.87", "activity": "ATP + hydrogencarbonate + L-threonine = diphosphate + H2O + L-threonylcarbamoyladenylate.", "evidence": [ { "id": "Q8SYJ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SYJ9" } ] }, { "ec_number": "2.7.7.87", "activity": "", "evidence": [ { "id": "Q8SYJ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SYJ9" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }