{ "uniprot_canonical_ac": "Q3U1Z5-1", "uniprot_ac": "Q3U1Z5", "uniprot_id": "GPSM3_MOUSE", "mass": { "chemical_mass": 17619.0, "monoisotopic_mass": 17619.0 }, "refseq": { "ac": "NP_598877", "name": "G-protein-signaling modulator 3", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598877" }, "gene_names": [ { "name": "Gpsm3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q3U1Z5", "id": "Q3U1Z5" }, { "name": "AGS4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598877", "id": "NP_598877" }, { "name": "Gpsm3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598877", "id": "NP_598877" } ], "protein_names": [ { "name": "G-protein-signaling modulator 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q3U1Z5" }, { "name": "G-protein-signaling modulator 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598877", "id": "NP_598877" } ], "function": [ { "annotation": "Findings suggest that GPSM3 acts as a direct negative regulator of NLRP3 function.", "evidence": [ { "database": "RefSeq", "id": "NP_598877", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598877" }, { "database": "PubMed", "id": "25271165", "url": "https://glygen.org/publication/PubMed/25271165" } ] }, { "annotation": "GPSM3 is an important regulator of monocyte function involving mechanisms of differentiation, survival, and chemotaxis, and deficiency in GPSM3 expression is protective in acute inflammatory arthritis.", "evidence": [ { "database": "RefSeq", "id": "NP_598877", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598877" }, { "database": "PubMed", "id": "23280397", "url": "https://glygen.org/publication/PubMed/23280397" } ] }, { "annotation": "Interacts with subunit of G(i) alpha proteins and regulates the activation of G(i) alpha proteins.", "evidence": [ { "database": "UniProtKB", "id": "Q3U1Z5", "url": "https://www.uniprot.org/uniprot/Q3U1Z5#function" } ] }, { "annotation": "The N-terminal region of G18 is a novel G protein-interacting domain that may have distinct regulatory effects within the G(i/o) subfamily", "evidence": [ { "database": "RefSeq", "id": "NP_598877", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598877" }, { "database": "PubMed", "id": "20097748", "url": "https://glygen.org/publication/PubMed/20097748" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3U1Z5", "url": "https://www.uniprot.org/uniprot/Q3U1Z5" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Gpsm3", "url": "https://www.uniprot.org/uniprot/Q3U1Z5", "locus": { "chromosome": "17", "start_pos": 34810728, "end_pos": 34808780, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000034786", "url": "https://www.ensembl.org/id/ENSMUSG00000034786" } ] } } ], "crossref": [ { "id": "ENSMUSG00000034786", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000034786", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "106512", "url": "https://www.ncbi.nlm.nih.gov/gene/106512", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003109", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003109", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011990", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011990", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042888", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042888", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:106512", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:106512", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "2146785", "url": "http://www.informatics.jax.org/marker/MGI:2146785", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "HQSQRME", "url": "https://omabrowser.org/oma/group/HQSQRME/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR47617", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47617", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47617:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47617:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02188", "url": "http://pfam.xfam.org/family/PF02188", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q3U1Z5", "url": "http://purl.obolibrary.org/obo/PR_Q3U1Z5", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418594", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_598877", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598877", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "G3UYL4", "url": "https://www.uniprot.org/uniprot/G3UYL4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3UYL4-1", "url": "https://www.uniprot.org/uniprot/G3UYL4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3UZQ1", "url": "https://www.uniprot.org/uniprot/G3UZQ1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3UZQ1-1", "url": "https://www.uniprot.org/uniprot/G3UZQ1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3U1Z5", "url": "https://www.uniprot.org/uniprot/Q3U1Z5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3U1Z5-1", "url": "https://www.uniprot.org/uniprot/Q3U1Z5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3U1Z5-2", "url": "https://www.uniprot.org/uniprot/Q3U1Z5-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEAERPQEEDGEQSLPQDDQGWPPVNATARPWRSAPPSPPPPGTRHTALGPRSGSLLSLQTELLLDLVAEAQSRRLEEQRATFHTPEAPPNLAPAPPRLLEDKEQLYSTILSHQCQRIEAQRSDPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC", "length": 159, "header": "sp|Q3U1Z5-1|GPSM3_MOUSE Isoform 1 of G-protein-signaling modulator 3 OS=Mus musculus OX=10090 GN=Gpsm3 PE=1 SV=2 CANONICAL=Q3U1Z5-1" }, "isoforms": [ { "isoform_ac": "G3UYL4-1", "url": "", "sequence": { "sequence": "ERPQEEDGEQCQRIEAQRSDPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC", "length": 55, "header": "tr|G3UYL4-1|GPSM3_MOUSE Computationally mapped isoform of G-protein-signaling modulator 3 OS=Mus musculus OX=10090 GN=Gpsm3 PE=1 SV=1 CANONICAL=Q3U1Z5-1" }, "locus": { "chromosome": "17", "start_pos": 34810278, "end_pos": 34809205, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000173772.2", "url": "https://www.ensembl.org/id/ENSMUST00000173772.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000134130.2", "url": "https://www.ensembl.org/id/ENSMUSP00000134130.2" } ] } }, { "isoform_ac": "G3UZQ1-1", "url": "", "sequence": { "sequence": "MEAERPQEEDGEQSLPQDDQGWPPVNATARPWRSAPPSPPPPGTRHTD", "length": 48, "header": "tr|G3UZQ1-1|G3UZQ1_MOUSE Computationally mapped isoform of G-protein signalling modulator 3 (AGS3-like, C. elegans) OS=Mus musculus OX=10090 GN=Gpsm3 PE=1 SV=1 CANONICAL=Q3U1Z5-1" }, "locus": { "chromosome": "17", "start_pos": 34809755, "end_pos": 34809196, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000150924.2", "url": "https://www.ensembl.org/id/ENSMUST00000150924.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000134586.2", "url": "https://www.ensembl.org/id/ENSMUSP00000134586.2" } ] } }, { "isoform_ac": "Q3U1Z5-1", "url": "", "sequence": { "sequence": "MEAERPQEEDGEQSLPQDDQGWPPVNATARPWRSAPPSPPPPGTRHTALGPRSGSLLSLQTELLLDLVAEAQSRRLEEQRATFHTPEAPPNLAPAPPRLLEDKEQLYSTILSHQCQRIEAQRSDPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC", "length": 159, "header": "sp|Q3U1Z5-1|GPSM3_MOUSE Isoform 1 of G-protein-signaling modulator 3 OS=Mus musculus OX=10090 GN=Gpsm3 PE=1 SV=2 CANONICAL=Q3U1Z5-1" }, "locus": { "chromosome": "17", "start_pos": 34810278, "end_pos": 34809196, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000038244", "url": "https://www.ensembl.org/id/ENSMUST00000038244" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000045911", "url": "https://www.ensembl.org/id/ENSMUSP00000045911" } ] } }, { "isoform_ac": "Q3U1Z5-2", "url": "", "sequence": { "sequence": "MPPLGLGDLLLPPLLLLEPDTQTELLLDLVAEAQSRRLEEQRATFHTPEAPPNLAPAPPRLLEDKEQLYSTILSHQCQRIEAQRSDPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC", "length": 121, "header": "sp|Q3U1Z5-2|GPSM3_MOUSE Isoform 2 of G-protein-signaling modulator 3 OS=Mus musculus OX=10090 GN=Gpsm3 PE=1 SV=2 CANONICAL=Q3U1Z5-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q3U1Z5", "url": "https://www.uniprot.org/uniprot/Q3U1Z5" } ], "site_lbl": "Ser34" }, { "start_pos": 38, "end_pos": 38, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q3U1Z5", "url": "https://www.uniprot.org/uniprot/Q3U1Z5" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" }, { "database": "phospho.ELM", "id": "Q3U1Z5", "url": "http://phospho.elm.eu.org/byAccession/Q3U1Z5.html" }, { "database": "iPTMnet", "id": "Q3U1Z5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q3U1Z5" } ], "site_lbl": "Ser38" }, { "start_pos": 55, "end_pos": 55, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q3U1Z5", "url": "https://www.uniprot.org/uniprot/Q3U1Z5" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" }, { "database": "phospho.ELM", "id": "Q3U1Z5", "url": "http://phospho.elm.eu.org/byAccession/Q3U1Z5.html" }, { "database": "iPTMnet", "id": "Q3U1Z5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q3U1Z5" } ], "site_lbl": "Ser55" }, { "start_pos": 58, "end_pos": 58, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q3U1Z5", "url": "https://www.uniprot.org/uniprot/Q3U1Z5" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" }, { "database": "phospho.ELM", "id": "Q3U1Z5", "url": "http://phospho.elm.eu.org/byAccession/Q3U1Z5.html" }, { "database": "iPTMnet", "id": "Q3U1Z5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q3U1Z5" } ], "site_lbl": "Ser58" }, { "start_pos": 61, "end_pos": 61, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q3U1Z5", "url": "https://www.uniprot.org/uniprot/Q3U1Z5" } ], "site_lbl": "Thr61" } ], "glycation": [], "keywords": [], "publication": [ { "title": "The phagosomal proteome in interferon-gamma-activated macrophages.", "journal": "Immunity", "date": "2009", "authors": "Trost M, English L, Lemieux S, Courcelles M, Desjardins M, Thibault P", "evidence": [ { "database": "UniProtKB", "id": "Q3U1Z5", "url": "https://www.uniprot.org/uniprot/Q3U1Z5" }, { "database": "UniProtKB", "id": "G3UZQ1", "url": "https://www.uniprot.org/uniprot/G3UZQ1" }, { "database": "iPTMnet", "id": "Q3U1Z5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q3U1Z5" } ], "reference": [ { "type": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" } ] }, { "title": "The proline-rich N-terminal domain of G18 exhibits a novel G protein regulatory function.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Zhao P, Nguyen CH, Chidiac P", "evidence": [ { "database": "RefSeq", "id": "NP_598877", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598877" } ], "reference": [ { "type": "PubMed", "id": "20097748", "url": "https://glygen.org/publication/PubMed/20097748" } ] }, { "title": "G-protein signaling modulator-3, a gene linked to autoimmune diseases, regulates monocyte function and its deficiency protects from inflammatory arthritis.", "journal": "Molecular immunology", "date": "2013", "authors": "Giguere PM, Billard MJ, Laroche G, Buckley BK, Timoshchenko RG, McGinnis MW, Esserman D, Foreman O, Liu P, Siderovski DP, Tarrant TK", "evidence": [ { "database": "RefSeq", "id": "NP_598877", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598877" } ], "reference": [ { "type": "PubMed", "id": "23280397", "url": "https://glygen.org/publication/PubMed/23280397" } ] }, { "title": "G Protein signaling modulator-3 inhibits the inflammasome activity of NLRP3.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Giguere PM, Gall BJ, Ezekwe EA Jr, Laroche G, Buckley BK, Kebaier C, Wilson JE, Ting JP, Siderovski DP, Duncan JA", "evidence": [ { "database": "RefSeq", "id": "NP_598877", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_598877" } ], "reference": [ { "type": "PubMed", "id": "25271165", "url": "https://glygen.org/publication/PubMed/25271165" } ] } ], "pathway": [ { "id": "mmu:106512", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:106512", "resource": "KEGG Pathway" }, { "id": "R-MMU-418594", "name": "G alpha (i) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-418594", "resource": "Reactome", "description": "G alpha (i) signalling events" } ], "orthologs": [ { "uniprot_canonical_ac": "Q6MG88-1", "protein_name": "G-protein-signaling modulator 3", "gene_name": "Gpsm3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEAERPQEDGEQSLPQDDQGWPPVNSTARPWRSAPPSPPPPGTRHTALGPRSGSLLSLQTELLLDLVAEAQSRRLEEQRAAFHTPKVPPSLAPTPPRLLEDKEQLYSTILSHQCQRIEAQRSDPPLPPGGQELLELLLRVQGGGRMEDQRSRPPTHTC", "length": 158 }, "evidence": [ { "id": "45241412", "url": "http://www.informatics.jax.org/homology/45241412", "database": "MGI" }, { "id": "Q3U1Z5", "url": "https://omabrowser.org/oma/group/Q3U1Z5/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9Y4H4-1", "protein_name": "G-protein-signaling modulator 3", "gene_name": "GPSM3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSLQTELLLDLVAEAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC", "length": 160 }, "evidence": [ { "id": "45241412", "url": "http://www.informatics.jax.org/homology/45241412", "database": "MGI" }, { "id": "Q3U1Z5", "url": "https://omabrowser.org/oma/group/Q3U1Z5/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "regulation of inflammatory response", "id": "GO:0050727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050727", "evidence": [ { "database": "UniProtKB", "id": "Q3U1Z5", "url": "https://www.uniprot.org/uniprot/Q3U1Z5" } ], "pmid": "" }, { "name": "positive regulation of inflammatory response", "id": "GO:0050729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050729", "evidence": [ { "database": "UniProtKB", "id": "Q3U1Z5", "url": "https://www.uniprot.org/uniprot/Q3U1Z5" } ], "pmid": "" }, { "name": "positive regulation of leukocyte chemotaxis", "id": "GO:0002690", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002690", "evidence": [ { "database": "UniProtKB", "id": "Q3U1Z5", "url": "https://www.uniprot.org/uniprot/Q3U1Z5" } ], "pmid": "" }, { "name": "positive regulation of cytokine production involved in inflammatory response", "id": "GO:1900017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900017", "evidence": [ { "database": "UniProtKB", "id": "Q3U1Z5", "url": "https://www.uniprot.org/uniprot/Q3U1Z5" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "GTPase regulator activity", "id": "GO:0030695", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030695", "evidence": [ { "database": "UniProtKB", "id": "Q3U1Z5", "url": "https://www.uniprot.org/uniprot/Q3U1Z5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q3U1Z5", "url": "https://www.uniprot.org/uniprot/Q3U1Z5" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q3U1Z5", "url": "https://www.uniprot.org/uniprot/Q3U1Z5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 26, "end_pos": 28, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }