{ "uniprot_canonical_ac": "Q3TZX3-1", "uniprot_ac": "Q3TZX3", "uniprot_id": "S2533_MOUSE", "mass": { "chemical_mass": 35064.0, "monoisotopic_mass": 35064.0 }, "refseq": { "ac": "NP_081736", "name": "solute carrier family 25 member 33", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081736" }, "gene_names": [ { "name": "Slc25a33", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q3TZX3", "id": "Q3TZX3" }, { "name": "5730438N18Rik; Pnc1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081736", "id": "NP_081736" }, { "name": "Slc25a33", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081736", "id": "NP_081736" } ], "protein_names": [ { "name": "Solute carrier family 25 member 33", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q3TZX3" }, { "name": "novel mitochondrial carrier protein domains containing protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081736", "id": "NP_081736" }, { "name": "solute carrier family 25 member 33", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081736", "id": "NP_081736" } ], "function": [ { "annotation": "Mitochondrial transporter that imports/exports pyrimidine nucleotides into and from mitochondria. Selectively transports uridine, thymidine, guanosine, cytosine and inosine (deoxy)nucleoside di- and triphosphates by an antiport mechanism (By similarity). May import (deoxy)nucleoside triphosphates in exchange for intramitochondrial (deoxy)nucleoside diphosphates, thus providing precursors necessary for de novo synthesis of mitochondrial DNA and RNA while exporting products of their catabolism (By similarity). Participates in mitochondrial genome maintenance, regulation of mitochondrial membrane potential and mitochondrial respiration (By similarity). Upon INS or IGF1 stimulation regulates cell growth and proliferation by controlling mitochondrial DNA replication and transcription, the ratio of mitochondria-to nuclear-encoded components of the electron transport chain resulting in control of mitochondrial ROS production (PubMed:17596519). Participates in dendritic cell endocytosis and may associate with mitochondrial oxidative phosphorylation (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3#function" }, { "database": "UniProtKB", "id": "Q9BSK2", "url": "https://www.uniprot.org/uniprot/Q9BSK2#function" }, { "database": "PubMed", "id": "17596519", "url": "https://glygen.org/publication/PubMed/17596519" } ] }, { "annotation": "The data indicate that PNC1 is a target of the IGF-I/mTOR pathway that is essential for mitochondrial activity in regulating cell growth and proliferation.", "evidence": [ { "database": "RefSeq", "id": "NP_081736", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081736" }, { "database": "PubMed", "id": "17596519", "url": "https://glygen.org/publication/PubMed/17596519" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Slc25a33", "url": "https://www.uniprot.org/uniprot/Q3TZX3", "locus": { "chromosome": "4", "start_pos": 149828493, "end_pos": 149858734, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000028982", "url": "https://www.ensembl.org/id/ENSMUSG00000028982" } ] } } ], "crossref": [ { "id": "ENSMUSG00000028982", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000028982", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "70556", "url": "https://www.ncbi.nlm.nih.gov/gene/70556", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR018108", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018108", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023395", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023395", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:70556", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:70556", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1917806", "url": "http://www.informatics.jax.org/marker/MGI:1917806", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "AFYNGMG", "url": "https://omabrowser.org/oma/group/AFYNGMG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4772at2759", "url": "http://www.orthodb.org/?query=4772at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45829", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45829", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45829:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45829:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00153", "url": "http://pfam.xfam.org/family/PF00153", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q3TZX3", "url": "http://purl.obolibrary.org/obo/PR_Q3TZX3", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_081736", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081736", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "73515", "url": "https://www.rhea-db.org/rhea/73515", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73519", "url": "https://www.rhea-db.org/rhea/73519", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73523", "url": "https://www.rhea-db.org/rhea/73523", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73527", "url": "https://www.rhea-db.org/rhea/73527", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73531", "url": "https://www.rhea-db.org/rhea/73531", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73535", "url": "https://www.rhea-db.org/rhea/73535", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73539", "url": "https://www.rhea-db.org/rhea/73539", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73543", "url": "https://www.rhea-db.org/rhea/73543", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73547", "url": "https://www.rhea-db.org/rhea/73547", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73551", "url": "https://www.rhea-db.org/rhea/73551", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73559", "url": "https://www.rhea-db.org/rhea/73559", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73563", "url": "https://www.rhea-db.org/rhea/73563", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73567", "url": "https://www.rhea-db.org/rhea/73567", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3TZX3-1", "url": "https://www.uniprot.org/uniprot/Q3TZX3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MATGTQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLLQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPNSNTVHILSAGSAAFVTNTLMNPIWMVKTRMQLERKVRGCKQMNTLQCARRVYQTEGVRGFYRGLTASYAGISETIICFAIYESLKKCLKDAPIVSSTDGAEKSSSGFFGLMAAAAVSKGCASCIAYPHEVIRTRLREEGSKYRSFVQTARLVFREEGYLAFYRGLFAQLIRQIPNTAIVLSTYEFIVYLLGERA", "length": 320, "header": "sp|Q3TZX3-1|S2533_MOUSE Isoform 1 of Solute carrier family 25 member 33 OS=Mus musculus OX=10090 GN=Slc25a33 PE=2 SV=1 CANONICAL=Q3TZX3-1" }, "isoforms": [ { "isoform_ac": "Q3TZX3-1", "url": "", "sequence": { "sequence": "MATGTQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLLQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPNSNTVHILSAGSAAFVTNTLMNPIWMVKTRMQLERKVRGCKQMNTLQCARRVYQTEGVRGFYRGLTASYAGISETIICFAIYESLKKCLKDAPIVSSTDGAEKSSSGFFGLMAAAAVSKGCASCIAYPHEVIRTRLREEGSKYRSFVQTARLVFREEGYLAFYRGLFAQLIRQIPNTAIVLSTYEFIVYLLGERA", "length": 320, "header": "sp|Q3TZX3-1|S2533_MOUSE Isoform 1 of Solute carrier family 25 member 33 OS=Mus musculus OX=10090 GN=Slc25a33 PE=2 SV=1 CANONICAL=Q3TZX3-1" }, "locus": { "chromosome": "4", "start_pos": 149858512, "end_pos": 149829198, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000105686", "url": "https://www.ensembl.org/id/ENSMUST00000105686" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000101311", "url": "https://www.ensembl.org/id/ENSMUSP00000101311" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The insulin-like growth factor-I-mTOR signaling pathway induces the mitochondrial pyrimidine nucleotide carrier to promote cell growth.", "journal": "Mol. Biol. Cell", "date": "2007", "authors": "Floyd S, Favre C, Lasorsa FM, Leahy M, Trigiante G, Stroebel P, Marx A, Loughran G, O'Callaghan K, Marobbio CM, Slotboom DJ, Kunji ER, Palmieri F, O'Connor R", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" }, { "database": "RefSeq", "id": "NP_081736", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081736" } ], "reference": [ { "type": "PubMed", "id": "17596519", "url": "https://glygen.org/publication/PubMed/17596519" } ] } ], "pathway": [ { "id": "mmu:70556", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:70556", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P40556-1", "protein_name": "Mitochondrial nicotinamide adenine dinucleotide transporter 1", "gene_name": "YIA6", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MTQTDNPVPNCGLLPEQQYCSADHEEPLLLHEEQLIFPDHSSQLSSADIIEPIKMNSSTESIIGTTLRKKWVPLSSTQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEYFRNRLENISTMVI", "length": 373 }, "evidence": [ { "id": "Q3TZX3", "url": "https://omabrowser.org/oma/group/Q3TZX3/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q9BSK2-1", "protein_name": "Solute carrier family 25 member 33", "gene_name": "SLC25A33", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MATGGQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLFQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPNSNIVHIFSAGSAAFITNSLMNPIWMVKTRMQLEQKVRGSKQMNTLQCARYVYQTEGIRGFYRGLTASYAGISETIICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCIAYPHEVIRTRLREEGTKYKSFVQTARLVFREEGYLAFYRGLFAQLIRQIPNTAIVLSTYELIVYLLEDRTQ", "length": 321 }, "evidence": [ { "id": "45232402", "url": "http://www.informatics.jax.org/homology/45232402", "database": "MGI" }, { "id": "Q3TZX3", "url": "https://omabrowser.org/oma/group/Q3TZX3/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "pmid": "" }, { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "pmid": "" }, { "name": "mitochondrial membrane", "id": "GO:0031966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031966", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 14, "go_terms": [ { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "pmid": "" }, { "name": "positive regulation of cell growth", "id": "GO:0030307", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030307", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "pmid": "" }, { "name": "cellular response to insulin stimulus", "id": "GO:0032869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032869", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "pmid": "" }, { "name": "regulation of mitochondrial membrane potential", "id": "GO:0051881", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051881", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "pmid": "" }, { "name": "mitochondrion organization", "id": "GO:0007005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007005", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "pmid": "" }, { "name": "mitochondrial genome maintenance", "id": "GO:0000002", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000002", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "pmid": "" }, { "name": "regulation of oxidative phosphorylation", "id": "GO:0002082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002082", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "pmid": "" }, { "name": "regulation of reactive oxygen species biosynthetic process", "id": "GO:1903426", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903426", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "pmid": "" }, { "name": "pyrimidine nucleotide transport", "id": "GO:0006864", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006864", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "pmid": "" }, { "name": "mitochondria-nucleus signaling pathway", "id": "GO:0031930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031930", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "pmid": "" }, { "name": "pyrimidine nucleotide import into mitochondrion", "id": "GO:1990519", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990519", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "pmid": "" }, { "name": "mitochondrial respiratory chain complex III assembly", "id": "GO:0034551", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034551", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "pmid": "" }, { "name": "cellular response to insulin-like growth factor stimulus", "id": "GO:1990314", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990314", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "pmid": "" }, { "name": "mitochondrial transcription", "id": "GO:0006390", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006390", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "pyrimidine nucleotide transmembrane transporter activity", "id": "GO:0015218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015218", "evidence": [ { "database": "UniProtKB", "id": "Q3TZX3", "url": "https://www.uniprot.org/uniprot/Q3TZX3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "73515", "name": "", "equation": "UDP(out) + UTP(in) = UDP(in) + UTP(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73515", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73515" } ] }, { "id": "73519", "name": "", "equation": "dUTP(out) + UTP(in) = dUTP(in) + UTP(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73519", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73519" } ] }, { "id": "73523", "name": "", "equation": "TTP(out) + UTP(in) = TTP(in) + UTP(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73523", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73523" } ] }, { "id": "73527", "name": "", "equation": "TDP(out) + UTP(in) = TDP(in) + UTP(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73527", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73527" } ] }, { "id": "73531", "name": "", "equation": "CTP(out) + UTP(in) = CTP(in) + UTP(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73531", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73531" } ] }, { "id": "73535", "name": "", "equation": "CDP(out) + UTP(in) = CDP(in) + UTP(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73535", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73535" } ] }, { "id": "73539", "name": "", "equation": "dCTP(out) + UTP(in) = dCTP(in) + UTP(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73539", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73539" } ] }, { "id": "73543", "name": "", "equation": "dCDP(out) + UTP(in) = dCDP(in) + UTP(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73543", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73543" } ] }, { "id": "73547", "name": "", "equation": "GTP(out) + UTP(in) = GTP(in) + UTP(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73547", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73547" } ] }, { "id": "73551", "name": "", "equation": "GDP(out) + UTP(in) = GDP(in) + UTP(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73551", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73551" } ] }, { "id": "73559", "name": "", "equation": "dGTP(out) + UTP(in) = dGTP(in) + UTP(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73559", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73559" } ] }, { "id": "73563", "name": "", "equation": "dGDP(out) + UTP(in) = dGDP(in) + UTP(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73563", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73563" } ] }, { "id": "73567", "name": "", "equation": "ITP(out) + UTP(in) = ITP(in) + UTP(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73567", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73567" } ] } ], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }