{ "uniprot_canonical_ac": "Q3TPJ7-1", "uniprot_ac": "Q3TPJ7", "uniprot_id": "MIDN_MOUSE", "mass": { "chemical_mass": 49192.0, "monoisotopic_mass": 49192.0 }, "refseq": { "ac": "NP_001292727", "name": "midnolin isoform 2", "summary": "This gene encodes a protein that contains an ubiquitin-like domain. This protein may be involved in the regulation of brain development as inferred by its high expression level in the embryonic midbrain. This protein has been found to negatively regulate glucokinase activity and insulin secretion in pancreatic beta cells. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292727" }, "gene_names": [ { "name": "Midn", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q3TPJ7", "id": "Q3TPJ7" }, { "name": "3000003C15Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292727", "id": "NP_001292727" }, { "name": "Midn", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292727", "id": "NP_001292727" } ], "protein_names": [ { "name": "Midnolin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q3TPJ7" }, { "name": "Midbrain nucleolar protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q3TPJ7" }, { "name": "midbrain nucleolar protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292727", "id": "NP_001292727" }, { "name": "midnolin isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292727", "id": "NP_001292727" } ], "function": [ { "annotation": "Facilitates ubiquitin-independent proteasomal degradation of polycomb protein CBX4 (PubMed:27326929). Plays a role in inhibiting the activity of glucokinase GCK and both glucose-induced and basal insulin secretion (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q3TPJ7", "url": "https://www.uniprot.org/uniprot/Q3TPJ7#function" }, { "database": "PubMed", "id": "27326929", "url": "https://glygen.org/publication/PubMed/27326929" }, { "database": "UniProtKB", "id": "D4AE48", "url": "https://www.uniprot.org/uniprot/D4AE48#function" } ] }, { "annotation": "Heterozygous midnolin knockout attenuates severity of nonalcoholic fatty liver disease in mice fed a Western-style diet high in fat, cholesterol, and fructose.", "evidence": [ { "database": "RefSeq", "id": "NP_001292727", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292727" }, { "database": "PubMed", "id": "37129245", "url": "https://glygen.org/publication/PubMed/37129245" } ] }, { "annotation": "Midnolin plays a role in cellular signaling of adult tissues and regulates glucokinase enzyme activity in pancreatic beta cells", "evidence": [ { "database": "RefSeq", "id": "NP_001292727", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292727" }, { "database": "PubMed", "id": "24187134", "url": "https://glygen.org/publication/PubMed/24187134" } ] }, { "annotation": "This gene encodes a protein that contains an ubiquitin-like domain. This protein may be involved in the regulation of brain development as inferred by its high expression level in the embryonic midbrain. This protein has been found to negatively regulate glucokinase activity and insulin secretion in pancreatic beta cells. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015].", "evidence": [ { "database": "RefSeq", "id": "NP_001292727", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292727" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q3TPJ7", "url": "https://www.uniprot.org/uniprot/Q3TPJ7" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Midn", "url": "https://www.uniprot.org/uniprot/Q3TPJ7", "locus": { "chromosome": "10", "start_pos": 79994202, "end_pos": 79984106, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000035621", "url": "https://www.ensembl.org/id/ENSMUSG00000035621" } ] } } ], "crossref": [ { "id": "ENSMUSG00000035621", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000035621", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd01804", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01804", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "59090", "url": "https://www.ncbi.nlm.nih.gov/gene/59090", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000626", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000626", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029071", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029071", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039336", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039336", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:59090", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:59090", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1890222", "url": "http://www.informatics.jax.org/marker/MGI:1890222", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q3TPJ7", "url": "https://oglcnac.org/atlas/detail/Q3TPJ7", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "Q3TPJ7", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q3TPJ7", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PSHDIGQ", "url": "https://omabrowser.org/oma/group/PSHDIGQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5322720at2759", "url": "http://www.orthodb.org/?query=5322720at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23010", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23010", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23010:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23010:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00240", "url": "http://pfam.xfam.org/family/PF00240", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q3TPJ7", "url": "http://purl.obolibrary.org/obo/PR_Q3TPJ7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001292727", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292727", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "D3YYX7", "url": "https://www.uniprot.org/uniprot/D3YYX7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YYX7-1", "url": "https://www.uniprot.org/uniprot/D3YYX7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YZI7", "url": "https://www.uniprot.org/uniprot/D3YZI7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YZI7-1", "url": "https://www.uniprot.org/uniprot/D3YZI7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z1J8", "url": "https://www.uniprot.org/uniprot/D3Z1J8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z1J8-1", "url": "https://www.uniprot.org/uniprot/D3Z1J8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z7H2", "url": "https://www.uniprot.org/uniprot/D3Z7H2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z7H2-1", "url": "https://www.uniprot.org/uniprot/D3Z7H2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3TPJ7", "url": "https://www.uniprot.org/uniprot/Q3TPJ7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3TPJ7-1", "url": "https://www.uniprot.org/uniprot/Q3TPJ7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3TPJ7-2", "url": "https://www.uniprot.org/uniprot/Q3TPJ7-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3TPJ7-3", "url": "https://www.uniprot.org/uniprot/Q3TPJ7-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEPQPGGARSCRRGAPGGACELNTATESAAPMSLAIHSTTGTRYDLSVPHDETVEGLRKRLSQRLKVPKERLALLHKDTRLSSGKLQEFGVGDGSKLTLVPTVEAGLMSQASRPEQSVMQALESLTETQVSDFLSGRSPLTLALRVGDHMMFVQLQLAAQHAPLQHRHVLAAAAAAAAAARGDSSVATPVSSPCRPVSSAARVPPVSSSPSSPVSPSPVTAGSFRSHAASTTCPEQMDCSPPASSSSTSTPGSSPTPRSRKPGAVIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPRRDIGTILQILNDLLSATRHYQGMPPSLTQLRCHAQCSPASPAPDLTPKTTSCEKLAATSSTSLLQGQSQIRMCKPPGDRLRQTENRATRCKVERLQLLLQQKRLRRKARRDARGPYHWTPSRKAGRSDSSSSGGGGGPSEATGLGLDFEDSVWKPEVNPDIQSEFVVA", "length": 465, "header": "sp|Q3TPJ7-1|MIDN_MOUSE Isoform 1 of Midnolin OS=Mus musculus OX=10090 GN=Midn PE=2 SV=1 CANONICAL=Q3TPJ7-1" }, "isoforms": [ { "isoform_ac": "D3YYX7-1", "url": "", "sequence": { "sequence": "MEPQPGGARSCRRGAPGGACELNTATESAAPMSLAIHSTTGTRYDLSVPHDETVEGLRKRLSQRLKV", "length": 67, "header": "tr|D3YYX7-1|D3YYX7_MOUSE Computationally mapped isoform of Midnolin OS=Mus musculus OX=10090 GN=Midn PE=4 SV=1 CANONICAL=Q3TPJ7-1" }, "locus": { "chromosome": "10", "start_pos": 79986112, "end_pos": 79985912, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000151202.2", "url": "https://www.ensembl.org/id/ENSMUST00000151202.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000115717.2", "url": "https://www.ensembl.org/id/ENSMUSP00000115717.2" } ] } }, { "isoform_ac": "D3YZI7-1", "url": "", "sequence": { "sequence": "MSQASRPEQSVMQALESLTETQPPATPGPGRAAGGGFRKYRLILFKRPWHRQGPQSP", "length": 57, "header": "tr|D3YZI7-1|D3YZI7_MOUSE Computationally mapped isoform of Midnolin OS=Mus musculus OX=10090 GN=Midn PE=4 SV=1 CANONICAL=Q3TPJ7-1" }, "locus": { "chromosome": "10", "start_pos": 79989529, "end_pos": 79987297, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000144526.2", "url": "https://www.ensembl.org/id/ENSMUST00000144526.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000120988.2", "url": "https://www.ensembl.org/id/ENSMUSP00000120988.2" } ] } }, { "isoform_ac": "D3Z1J8-1", "url": "", "sequence": { "sequence": "MSQASRPEQSVMQALESLTETQPPATPGPGRAAGGGFRKYRLILFKRPWHRQGPQSPERGGERPQVSDFLSGRSPLTLALRV", "length": 82, "header": "tr|D3Z1J8-1|MIDN_MOUSE Computationally mapped isoform of Midnolin OS=Mus musculus OX=10090 GN=Midn PE=2 SV=8 CANONICAL=Q3TPJ7-1" }, "locus": { "chromosome": "10", "start_pos": 79989700, "end_pos": 79987297, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000153477.8", "url": "https://www.ensembl.org/id/ENSMUST00000153477.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000119787.2", "url": "https://www.ensembl.org/id/ENSMUSP00000119787.2" } ] } }, { "isoform_ac": "D3Z7H2-1", "url": "", "sequence": { "sequence": "MSQASRPEQSVMQALESLTETQVSDFLSGRSPLTLALRVGDHMMFVQLQLAAQHAPLQHRHVLAAAAAAAAAARGDSSVATPVSSPCRPVSSAARVPPVSSSPSSPVSPSPVTAGSFRSHAASTTCPEQMDCSPPASSSSTSTPGSSPTPRSRKPGAVIESFVNHAPGVFSGTFS", "length": 175, "header": "tr|D3Z7H2-1|MIDN_MOUSE Computationally mapped isoform of Midnolin OS=Mus musculus OX=10090 GN=Midn PE=2 SV=1 CANONICAL=Q3TPJ7-1" }, "locus": { "chromosome": "10", "start_pos": 79990305, "end_pos": 79987297, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000146516.8", "url": "https://www.ensembl.org/id/ENSMUST00000146516.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000119962.2", "url": "https://www.ensembl.org/id/ENSMUSP00000119962.2" } ] } }, { "isoform_ac": "Q3TPJ7-1", "url": "", "sequence": { "sequence": "MEPQPGGARSCRRGAPGGACELNTATESAAPMSLAIHSTTGTRYDLSVPHDETVEGLRKRLSQRLKVPKERLALLHKDTRLSSGKLQEFGVGDGSKLTLVPTVEAGLMSQASRPEQSVMQALESLTETQVSDFLSGRSPLTLALRVGDHMMFVQLQLAAQHAPLQHRHVLAAAAAAAAAARGDSSVATPVSSPCRPVSSAARVPPVSSSPSSPVSPSPVTAGSFRSHAASTTCPEQMDCSPPASSSSTSTPGSSPTPRSRKPGAVIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPRRDIGTILQILNDLLSATRHYQGMPPSLTQLRCHAQCSPASPAPDLTPKTTSCEKLAATSSTSLLQGQSQIRMCKPPGDRLRQTENRATRCKVERLQLLLQQKRLRRKARRDARGPYHWTPSRKAGRSDSSSSGGGGGPSEATGLGLDFEDSVWKPEVNPDIQSEFVVA", "length": 465, "header": "sp|Q3TPJ7-1|MIDN_MOUSE Isoform 1 of Midnolin OS=Mus musculus OX=10090 GN=Midn PE=2 SV=1 CANONICAL=Q3TPJ7-1" }, "locus": { "chromosome": "10", "start_pos": 79992473, "end_pos": 79985912, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000099492", "url": "https://www.ensembl.org/id/ENSMUST00000099492" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000097091", "url": "https://www.ensembl.org/id/ENSMUSP00000097091" } ] } }, { "isoform_ac": "Q3TPJ7-2", "url": "", "sequence": { "sequence": "MEPQPGGARSCRRGAPGGACELNTATESAAPMSLAIHSTTGTRYDLSVPHDETVEGLRKRLSQRLKVPKERLALLHKDTRLSSGKLQEFGVGDGSKLTLVPTVEAGLMSQASRPEQSVMQALESLTETQPPATPGPGRAAGGGFRKYRLILFKRPWHRQGPQSPERGGERPQVSDFLSGRSPLTLALRVGDHMMFVQLQLAAQHAPLQHRHVLAAAAAAAAAARGDSSVATPVSSPCRPVSSAARVPPVSSSPSSPVSPSPVTAGSFRSHAASTTCPEQMDCSPPASSSSTSTPGSSPTPRSRKPGAVIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPRRDIGTILQILNDLLSATRHYQGMPPSLTQLRCHAQCSPASPAPDLTPKTTSCEKLAATSSTSLLQGQSQIRMCKPPGDRLRQTENRATRCKVERLQLLLQQKRLRRKARRDARGPYHWTPSRKAGRSDSSSSGGGGGPSEATGLGLDFEDSVWKPEVNPDIQSEFVVA", "length": 508, "header": "sp|Q3TPJ7-2|MIDN_MOUSE Isoform 2 of Midnolin OS=Mus musculus OX=10090 GN=Midn PE=2 SV=1 CANONICAL=Q3TPJ7-1" }, "locus": { "chromosome": "10", "start_pos": 79992473, "end_pos": 79985912, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000042057", "url": "https://www.ensembl.org/id/ENSMUST00000042057" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000046967", "url": "https://www.ensembl.org/id/ENSMUSP00000046967" } ] } }, { "isoform_ac": "Q3TPJ7-3", "url": "", "sequence": { "sequence": "MEPQPGGARSCRRGAPGGACELNTATESAAPMSLAIHSTTGTRYDLSVPHDETVEGLRKRLSQRLKVPKERLALLHKDTRLSSGKLQEFGVGDGSKLTLVPTVEAGLMSQASRPEQSVMQALESLTETQPPATPGPGRAAGGGFRKYRLILFKRPWHRQGPQSPERGGERPQVSDFLSGRSPLTLALRVGDHMMFVQLQLAAQHAPLQHRHVLAAAAAAAAAARGDSSVATPVSSPCRPVSSAARVPPVSSSPSSPVSPSPVTAGSFRSHAASTTCPEMDCSPPASSSSTSTPGSSPTPRSRKPGAVIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPRRDIGTILQILNDLLSATRHYQGMPPSLTQLRCHAQCSPASPAPDLTPKTTSCEKLAATSSTSLLQGQSQIRMCKPPGDRLRQTENRATRCKVERLQLLLQQKRLRRKARRDARGPYHWTPSRKAGRSDSSSSGGGGGPSEATGLGLDFEDSVWKPEVNPDIQSEFVVA", "length": 507, "header": "sp|Q3TPJ7-3|MIDN_MOUSE Isoform 3 of Midnolin OS=Mus musculus OX=10090 GN=Midn PE=2 SV=1 CANONICAL=Q3TPJ7-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 191, "start_aa": "Ser", "end_pos": 191, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser191", "evidence": [ { "id": "Q3TPJ7", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q3TPJ7" }, { "id": "32782141", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32782141" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 207, "start_aa": "Ser", "end_pos": 207, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser207", "evidence": [ { "id": "Q3TPJ7", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q3TPJ7" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Novel nucleolar protein, midnolin, is expressed in the mesencephalon during mouse development.", "journal": "Gene", "date": "2000", "authors": "Tsukahara M, Suemori H, Noguchi S, Ji ZS, Tsunoo H", "evidence": [ { "database": "UniProtKB", "id": "Q3TPJ7", "url": "https://www.uniprot.org/uniprot/Q3TPJ7" } ], "reference": [ { "type": "PubMed", "id": "10974535", "url": "https://glygen.org/publication/PubMed/10974535" } ] }, { "title": "Identification of the ubiquitin-like domain of midnolin as a new glucokinase interaction partner.", "journal": "J. Biol. Chem.", "date": "2013", "authors": "Hofmeister-Brix A, Kollmann K, Langer S, Schultz J, Lenzen S, Baltrusch S", "evidence": [ { "database": "UniProtKB", "id": "Q3TPJ7", "url": "https://www.uniprot.org/uniprot/Q3TPJ7" }, { "database": "RefSeq", "id": "NP_001292727", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292727" } ], "reference": [ { "type": "PubMed", "id": "24187134", "url": "https://glygen.org/publication/PubMed/24187134" } ] }, { "title": "Stuxnet facilitates the degradation of polycomb protein during development.", "journal": "Dev. Cell", "date": "2016", "authors": "Li Y., Liu M., Zhang J., Su Y., Du J., He T., Harte P.J., Tie F., Zhu A.J.", "evidence": [ { "database": "UniProtKB", "id": "Q3TPJ7", "url": "https://www.uniprot.org/uniprot/Q3TPJ7" } ], "reference": [ { "type": "PubMed", "id": "27326929", "url": "https://glygen.org/publication/PubMed/27326929" } ] }, { "title": "Cytosolic N-GlcNAc proteins are formed by the action of endo-beta-N-acetylglucosaminidase.", "journal": "Biochemical and biophysical research communications", "date": "2020", "authors": "Maynard JC, Fujihira H, Dolgonos GE, Suzuki T, Burlingame AL", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "Q3TPJ7", "url": "https://oglcnac.org/atlas/detail/Q3TPJ7" } ], "reference": [ { "type": "PubMed", "id": "32782141", "url": "https://glygen.org/publication/PubMed/32782141" } ] }, { "title": "Chemoproteomic and Transcriptomic Analysis Reveals that O-GlcNAc Regulates Mouse Embryonic Stem Cell Fate through the Pluripotency Network.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2023-02-27", "authors": "Hao Yi, Li Xiang, Qin Ke, Shi Yujie, He Yanwen, Zhang Che, Cheng Bo, Zhang Xiwen, Hu Guangyu, Liang Shuyu, Tang Qi, Chen Xing", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q3TPJ7", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q3TPJ7" } ], "reference": [ { "type": "PubMed", "id": "36852467", "url": "https://glygen.org/publication/PubMed/36852467" } ] }, { "title": "Heterozygous midnolin knockout attenuates severity of nonalcoholic fatty liver disease in mice fed a Western-style diet high in fat, cholesterol, and fructose.", "journal": "American journal of physiology. Gastrointestinal and liver physiology", "date": "2023-08-01", "authors": "Kweon Soo-Mi, Irimia-Dominguez Jose, Kim Gayeoun, Fueger Patrick T, Asahina Kinji, Lai Keith K, Allende Daniela S, Lai Quincy R, Lou Chih-Hong, Tsark Walter M, Yang Ju Dong, Ng Dominic S, Lee Ju-Seog, Tso Patrick, Huang Wendong, Lai Keane K Y", "evidence": [ { "database": "RefSeq", "id": "NP_001292727", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292727" } ], "reference": [ { "type": "PubMed", "id": "37129245", "url": "https://glygen.org/publication/PubMed/37129245" } ] } ], "pathway": [ { "id": "mmu:59090", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:59090", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D4AE48-1", "protein_name": "Midnolin", "gene_name": "Midn", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEPQPGGARSCRRGAPGGACELSTTAESAAPMSLAIHSTTGTRYDLSVPHDETVEGLRKRLSQRLKVPKERLALLHKDTRLSSGKLQEFGVGDGSKLTLVPTVEAGLMSQASRPEQSVMQALESLTETQPPATPGPGRAAGGGFRKYRLILFKRPWHRQGPQSPERGGERPQVSDFLSGRSPLTLALRVGDHMMFVQLQLAAQHAPLQHRHVLAAAAAAAAAARGDSSIATPVSSPCRPVSSAARVPPVSSSPSSPVSPSPVTAGTFQSHAASTTCPEQTDCSPPASSNTTSTPGSSPTPRSRKPGAVIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPRRDIGTILQILNDLLSATRHYQGMPASLTQLRCHAQCSPASPAPDLTPKTTSCEKLATPSLLQGQSQIRMCKPPGDRLRQTENRATRCKVERLQLLLQQKRLRRKARRDARGPYHWTPSRKAGRSDSSSSGGGGSPSEATGLGLDFEDSVWKPEVNPDIQSEFVVA", "length": 505 }, "evidence": [ { "id": "45235650", "url": "http://www.informatics.jax.org/homology/45235650", "database": "MGI" }, { "id": "Q3TPJ7", "url": "https://omabrowser.org/oma/group/Q3TPJ7/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q504T8-1", "protein_name": "Midnolin", "gene_name": "MIDN", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEPQPGGARSCRRGAPGGACELGPAAEAAPMSLAIHSTTGTRYDLAVPPDETVEGLRKRLSQRLKVPKERLALLHKDTRLSSGKLQEFGVGDGSKLTLVPTVEAGLMSQASRPEQSVMQALESLTETQVSDFLSGRSPLTLALRVGDHMMFVQLQLAAQHAPLQHRHVLAAAAAAAAARGDPSIASPVSSPCRPVSSAARVPPVPTSPSPASPSPITAGSFRSHAASTTCPEQMDCSPTASSSASPGASTTSTPGASPAPRSRKPGAVIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPRRDIGTILQILNDLLSATRHYQGMPPSLAQLRCHAQCSPASPAPDLAPRTTSCEKLTAAPSASLLQGQSQIRMCKPPGDRLRQTENRATRCKVERLQLLLQQKRLRRKARRDARGPYHWSPSRKAGRSDSSSSGGGGSPSEASGLGLDFEDSVWKPEVNPDIKSEFVVA", "length": 468 }, "evidence": [ { "id": "45235650", "url": "http://www.informatics.jax.org/homology/45235650", "database": "MGI" }, { "id": "Q3TPJ7", "url": "https://omabrowser.org/oma/group/Q3TPJ7/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q3TPJ7", "url": "https://www.uniprot.org/uniprot/Q3TPJ7" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "Q3TPJ7", "url": "https://www.uniprot.org/uniprot/Q3TPJ7" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q3TPJ7", "url": "https://www.uniprot.org/uniprot/Q3TPJ7" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q3TPJ7", "url": "https://www.uniprot.org/uniprot/Q3TPJ7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "kinase binding", "id": "GO:0019900", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019900", "evidence": [ { "database": "UniProtKB", "id": "Q3TPJ7", "url": "https://www.uniprot.org/uniprot/Q3TPJ7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "negative regulation of insulin secretion", "id": "GO:0046676", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046676", "evidence": [ { "database": "UniProtKB", "id": "Q3TPJ7", "url": "https://www.uniprot.org/uniprot/Q3TPJ7" } ], "pmid": "" }, { "name": "negative regulation of glucokinase activity", "id": "GO:0033132", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033132", "evidence": [ { "database": "UniProtKB", "id": "Q3TPJ7", "url": "https://www.uniprot.org/uniprot/Q3TPJ7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }