{ "uniprot_canonical_ac": "Q3E705-1", "uniprot_ac": "Q3E705", "uniprot_id": "EFG1P_YEAST", "mass": { "chemical_mass": 27121.0, "monoisotopic_mass": 27121.0 }, "refseq": { "ac": "NP_076891", "name": "Efg1p", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076891" }, "gene_names": [ { "name": "EFG1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q3E705", "id": "Q3E705" }, { "name": "EFG1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076891", "id": "NP_076891" }, { "name": "G9368", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q3E705", "id": "Q3E705" }, { "name": "YGR272C", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076891", "id": "NP_076891" }, { "name": "YGR272C", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q3E705", "id": "Q3E705" } ], "protein_names": [ { "name": "rRNA-processing protein EFG1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q3E705" }, { "name": "Efg1p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076891", "id": "NP_076891" }, { "name": "Exit from G1 protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q3E705" } ], "function": [ { "annotation": "Involved in rRNA processing. Required growth at elevated temperatures, resistance to hydroxyurea and for cell cycle progression.", "evidence": [ { "database": "UniProtKB", "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705#function" }, { "database": "PubMed", "id": "16510898", "url": "https://glygen.org/publication/PubMed/16510898" }, { "database": "PubMed", "id": "12837249", "url": "https://glygen.org/publication/PubMed/12837249" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705" } ], "common_name": "Yeast" } ], "gene": [ { "name": "EFG1", "url": "https://www.uniprot.org/uniprot/Q3E705", "locus": { "chromosome": "VII", "start_pos": 1037800, "end_pos": 1038501, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "YGR271C-A", "url": "https://www.ensembl.org/id/YGR271C-A" } ] } } ], "crossref": [ { "id": "853188", "url": "https://www.ncbi.nlm.nih.gov/gene/853188", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q3E705", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q3E705*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR019310", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019310", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "sce:YGR271C-A", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YGR271C-A", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "KHAQIDV", "url": "https://omabrowser.org/oma/group/KHAQIDV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1333547at2759", "url": "http://www.orthodb.org/?query=1333547at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR33911", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR33911", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR33911:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR33911:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF10153", "url": "http://pfam.xfam.org/family/PF10153", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q3E705", "url": "http://purl.obolibrary.org/obo/PR_Q3E705", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_076891", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076891", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "S000007608", "url": "https://www.yeastgenome.org/locus/S000007608", "database": "SGD", "categories": [ "Organism-specific" ] }, { "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3E705-1", "url": "https://www.uniprot.org/uniprot/Q3E705-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAKLQRKRSKALGSSLEMSQIMDAGTNKIKRRIRDLERLLKKKKDILPSTVIIEKERNLQALRLELQNNELKNKIKANAKKYHMVRFFEKKKALRKYNRLLKKIKESGADDKDLQQKLRATKIELCYVINFPKTEKYIALYPNDTPSTDPKGVELTNLRREQFLKLVAERMDANTLNVSFEEILKGKKLDEDSIGLTLSPDKDHEDGSQVSPTQDRKELDQVVGEDEKDDFFE", "length": 233, "header": "sp|Q3E705-1|EFG1P_YEAST Isoform 1 of rRNA-processing protein EFG1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=EFG1 PE=1 SV=2 CANONICAL=Q3E705-1" }, "isoforms": [ { "isoform_ac": "Q3E705-1", "url": "", "sequence": { "sequence": "MAKLQRKRSKALGSSLEMSQIMDAGTNKIKRRIRDLERLLKKKKDILPSTVIIEKERNLQALRLELQNNELKNKIKANAKKYHMVRFFEKKKALRKYNRLLKKIKESGADDKDLQQKLRATKIELCYVINFPKTEKYIALYPNDTPSTDPKGVELTNLRREQFLKLVAERMDANTLNVSFEEILKGKKLDEDSIGLTLSPDKDHEDGSQVSPTQDRKELDQVVGEDEKDDFFE", "length": 233, "header": "sp|Q3E705-1|EFG1P_YEAST Isoform 1 of rRNA-processing protein EFG1 OS=Saccharomyces cerevisiae S288C OX=559292 GN=EFG1 PE=1 SV=2 CANONICAL=Q3E705-1" }, "locus": { "chromosome": "VII", "start_pos": 1038501, "end_pos": 1037803, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "YGR271C-A_mRNA", "url": "https://www.ensembl.org/id/YGR271C-A_mRNA" }, { "database": "Ensembl Peptide", "id": "YGR271C-A", "url": "https://www.ensembl.org/id/YGR271C-A" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "A panoramic view of yeast noncoding RNA processing.", "journal": "Cell", "date": "2003", "authors": "Yang X., Zhang W., Krogan N.J., Greenblatt J.F., Cagney G., Emili A., Hughes T.R., Altschuler S.J., Wu L.F., Canadien V., Davierwala A.P., Mnaimneh S., Richards D.P., Datta N., Frey B.J., Robinson M.D., Ryan O.W., Beattie B., Grigull J., Jojic V., Mitsakakis N., Morris Q.D., Pal C., Peng W.-T., Roweis S.", "evidence": [ { "database": "UniProtKB", "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705" } ], "reference": [ { "type": "PubMed", "id": "12837249", "url": "https://glygen.org/publication/PubMed/12837249" } ] }, { "title": "Global analysis of protein localization in budding yeast.", "journal": "Nature", "date": "2003", "authors": "Weissman J.S., Carroll A.S., Howson R.W., Huh W.-K., O'Shea E.K., Falvo J.V., Gerke L.C.", "evidence": [ { "database": "UniProtKB", "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705" } ], "reference": [ { "type": "PubMed", "id": "14562095", "url": "https://glygen.org/publication/PubMed/14562095" } ] }, { "title": "Global analysis of protein expression in yeast.", "journal": "Nature", "date": "2003", "authors": "Dephoure N., Weissman J.S., Howson R.W., Huh W.-K., O'Shea E.K., Belle A., Bower K., Ghaemmaghami S.", "evidence": [ { "database": "UniProtKB", "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705" } ], "reference": [ { "type": "PubMed", "id": "14562106", "url": "https://glygen.org/publication/PubMed/14562106" } ] }, { "title": "Functional genomics of genes with small open reading frames (sORFs) in S. cerevisiae.", "journal": "Genome Res.", "date": "2006", "authors": "Boeke J.D., Yang H., Ni L., Davis R.W., Basrai M.A., Chu A., Au W.-C., Snyder M.A., Carter C.D., Kastenmayer J.P., Kitchen L.E., Wheeler D.", "evidence": [ { "database": "UniProtKB", "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705" } ], "reference": [ { "type": "PubMed", "id": "16510898", "url": "https://glygen.org/publication/PubMed/16510898" } ] }, { "title": "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2007", "authors": "Chi An, Huttenhower Curtis, Geer Lewis Y, Coon Joshua J, Syka John E P, Bai Dina L, Shabanowitz Jeffrey, Burke Daniel J, Troyanskaya Olga G, Hunt Donald F", "evidence": [ { "database": "UniProtKB", "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705" } ], "reference": [ { "type": "PubMed", "id": "17287358", "url": "https://glygen.org/publication/PubMed/17287358" } ] }, { "title": "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.", "journal": "Genome Res.", "date": "2007", "authors": "Hu Y., LaBaer J., Moreira D., Raphael J., Rolfs A., Zuo D., Richardson A., Simpson A.J.G., Zhu C., Harlow E., Camargo A.A., Jepson D., Kelley F., McCarron S., Taycher E., Kolodner R.D., Kane M.F., Williamson J., Berger M.F., Bulyk M.L., Bhullar B., Mohr S., Marsischky G., Murthy T.V.S.", "evidence": [ { "database": "UniProtKB", "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705" } ], "reference": [ { "type": "PubMed", "id": "17322287", "url": "https://glygen.org/publication/PubMed/17322287" } ] }, { "title": "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.", "journal": "J. Proteome Res.", "date": "2007", "authors": "Li Xue, Gerber Scott A, Rudner Adam D, Beausoleil Sean A, Haas Wilhelm, Vill\u00e9n Judit, Elias Joshua E, Gygi Steve P", "evidence": [ { "database": "UniProtKB", "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705" } ], "reference": [ { "type": "PubMed", "id": "17330950", "url": "https://glygen.org/publication/PubMed/17330950" } ] }, { "title": "The reference genome sequence of Saccharomyces cerevisiae: Then and now.", "journal": "G3 (Bethesda)", "date": "2014", "authors": "Engel Stacia R, Dietrich Fred S, Fisk Dianna G, Binkley Gail, Balakrishnan Rama, Costanzo Maria C, Dwight Selina S, Hitz Benjamin C, Karra Kalpana, Nash Robert S, Weng Shuai, Wong Edith D, Lloyd Paul, Skrzypek Marek S, Miyasato Stuart R, Simison Matt, Cherry J Michael", "evidence": [ { "database": "UniProtKB", "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705" } ], "reference": [ { "type": "PubMed", "id": "24374639", "url": "https://glygen.org/publication/PubMed/24374639" } ] }, { "title": "The sequence of a 8 kb segment on the right arm of yeast chromosome VII identifies four new open reading frames and the genes for yTAFII145.", "journal": "Yeast", "date": "1997", "authors": "Frontali L., Fabiani L., Marconi A., Montebove F., Ruzzi M., Saliola M.", "evidence": [ { "database": "UniProtKB", "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705" } ], "reference": [ { "type": "PubMed", "id": "9133740", "url": "https://glygen.org/publication/PubMed/9133740" } ] }, { "title": "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII.", "journal": "Nature", "date": "1997", "authors": "Mewes H.-W., Minenkova O., Schaefer M., Scharfe M., Wambutt R., Wedler H., Verhasselt P., Hansen M., Rose M., Durand P., Brueckner M., Plevani P., Netter P., Rieger M., Zimmermann M., Portetelle D., Wolf K., Bertani I., Delius H., Kleine K., Portillo F., Hofmann B., Albers M., Schaefer B., Kramer W., Castagnoli L., Volckaert G., Koetter P., Entian K.-D., Kramer B., Rinaldi T., Thierry A., Louis E.J., Vandenbol M., Martegani E., Robben J., Nombela C., Vanoni M., Arroyo J., Eraso P., Mazon M.J., James C.M., Carignani G., Dujon B., Feuermann M., Goffeau A., Hani J., Hilger F., Klima R., Mueller-Auer S., Oliver S.G., Potier S., Rodrigues-Pousada C., Schmidheini T., Souciet J.-L., Steensma H.Y., Zollner A., Bruschi C.V., Escribano V., Frontali L., Guerreiro P., Mazzoni C., Purnelle B., Rodriguez-Torres A.M., Skala J., Talla E., Voet M., de Wergifosse P., Agostoni-Carbone M.L., Albermann K., Backes U., Barreiros T., Bjourson A.J., Cerdan E., Clemente M.L., Coblenz A., Coglievina M., Coissac E., Defoor E., Del Bino S., Delneri D., Fabiani L., Fartmann B., Feroli F., Garcia-Gonzalez M., Garcia-Saez M.I., Hebling U., Hernandez K., Heumann K., Indge K.J., Lauquin G., Leuther H., Maillier E., Marconi A., McReynolds A.D.K., Melchioretto P., Nawrocki A., Neu R., Panzeri L., Paoluzi S., Riles L., Rodriguez-Belmonte E., Ruzzi M., Saliola M., Sanchez-Perez M., Schreer A., Tettelin H., Van Dyck L., Watson M.D., Weber N., Wedler E., Wipfli P., Wright L.F., Zaccaria P., van der Aart Q.J.M.", "evidence": [ { "database": "UniProtKB", "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705" } ], "reference": [ { "type": "PubMed", "id": "9169869", "url": "https://glygen.org/publication/PubMed/9169869" } ] } ], "pathway": [ { "id": "sce:YGR271C-A", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+sce:YGR271C-A", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705" } ], "pmid": "" }, { "name": "preribosome, small subunit precursor", "id": "GO:0030688", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030688", "evidence": [ { "database": "UniProtKB", "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705" } ], "pmid": "" }, { "name": "nucleolar preribosome", "id": "GO:0030685", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030685", "evidence": [ { "database": "UniProtKB", "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)", "id": "GO:0000462", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000462", "evidence": [ { "database": "UniProtKB", "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705" } ], "pmid": "" }, { "name": "nuclear RNA surveillance", "id": "GO:0071027", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071027", "evidence": [ { "database": "UniProtKB", "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705" } ], "pmid": "" }, { "name": "re-entry into mitotic cell cycle after pheromone arrest", "id": "GO:0000321", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000321", "evidence": [ { "database": "UniProtKB", "id": "Q3E705", "url": "https://www.uniprot.org/uniprot/Q3E705" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 143, "end_pos": 145, "annotation": "n_glycosylation_sequon" }, { "start_pos": 177, "end_pos": 179, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }