{ "uniprot_canonical_ac": "Q32Q92-1", "uniprot_ac": "Q32Q92", "uniprot_id": "ACOT6_MOUSE", "mass": { "chemical_mass": 46769.0, "monoisotopic_mass": 46769.0 }, "refseq": { "ac": "NP_766168", "name": "acyl-coenzyme A thioesterase 6 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766168" }, "gene_names": [ { "name": "Acot6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q32Q92", "id": "Q32Q92" }, { "name": "4632408A20Rik; A330054B07", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766168", "id": "NP_766168" }, { "name": "Acot6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766168", "id": "NP_766168" } ], "protein_names": [ { "name": "Acyl-coenzyme A thioesterase 6", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q32Q92" }, { "name": "3.1.2.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q32Q92" }, { "name": "Acyl-CoA thioesterase 6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q32Q92" }, { "name": "acyl-coenzyme A thioesterase 6 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766168", "id": "NP_766168" }, { "name": "acyl-coenzyme A thioesterase 6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766168", "id": "NP_766168" } ], "function": [ { "annotation": "Acot6 was identified as a target gene of the peroxisome proliferator-activated receptor alpha (PPARalpha) and is up-regulated in mouse liver in a PPARalpha-dependent manner.", "evidence": [ { "database": "RefSeq", "id": "NP_766168", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766168" }, { "database": "PubMed", "id": "17613526", "url": "https://glygen.org/publication/PubMed/17613526" } ] }, { "annotation": "Catalyzes the hydrolysis of acyl-CoAs into free fatty acids and coenzyme A (CoASH), regulating their respective intracellular levels. Catalyzes the hydrolysis of phytanoyl-CoA and pristanoyl-CoA, two methyl-branched fatty acids derived from phytol, that enter the body via the diet.", "evidence": [ { "database": "UniProtKB", "id": "Q32Q92", "url": "https://www.uniprot.org/uniprot/Q32Q92#function" }, { "database": "PubMed", "id": "17613526", "url": "https://glygen.org/publication/PubMed/17613526" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q32Q92", "url": "https://www.uniprot.org/uniprot/Q32Q92" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Acot6", "url": "https://www.uniprot.org/uniprot/Q32Q92", "locus": { "chromosome": "12", "start_pos": 84158123, "end_pos": 84147428, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000043487", "url": "https://www.ensembl.org/id/ENSMUSG00000043487" } ] } } ], "crossref": [ { "id": "ENSMUSG00000043487", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000043487", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "217700", "url": "https://www.ncbi.nlm.nih.gov/gene/217700", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR006862", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006862", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014940", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014940", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016662", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016662", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029058", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029058", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042490", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042490", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:217700", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:217700", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1921287", "url": "http://www.informatics.jax.org/marker/MGI:1921287", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "ISKPHAM", "url": "https://omabrowser.org/oma/group/ISKPHAM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5356064at2759", "url": "http://www.orthodb.org/?query=5356064at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10824", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10824", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10824:SF17", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10824:SF17", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04775", "url": "http://pfam.xfam.org/family/PF04775", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08840", "url": "http://pfam.xfam.org/family/PF08840", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q32Q92", "url": "http://purl.obolibrary.org/obo/PR_Q32Q92", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-390247", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-390247", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_766168", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766168", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "40415", "url": "https://www.rhea-db.org/rhea/40415", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "40419", "url": "https://www.rhea-db.org/rhea/40419", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q32Q92", "url": "https://www.uniprot.org/uniprot/Q32Q92", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q32Q92-1", "url": "https://www.uniprot.org/uniprot/Q32Q92-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q32Q92-2", "url": "https://www.uniprot.org/uniprot/Q32Q92-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAATLSVEPAGRSCWDEPLSIAVRGLAPEQPVTLRSVLRDEKGMLFRAHARYRADSHGELDLARTPALGGSFSGLEPMGLLWAMEPDRPFWRLIKRDVQIPFVVELEVLDGHEPDGGQRLARAVHERHFMAPGVRRVPVREGRVRATLFLPPGKGQFPGIIDLYGSIGGLCEHRASLLAGHGFAVLALAYFQFEDLPENLSDVRLEYFEEALALMLRHPQVKGPNIGLIGVSKGADLCLSMAAFLKDNITATVLINACVANTLVPLYYKDLFVPELGCDQTKNKSGLMDLRDMWNNPLEEPNHQSLIPLEKAQGPFLFLVGMDDHNWKSDVYARIACERLQAHGKDRPQIIYYPETGHCIEPPYFPPPIATVHFVLGEAVFNGGKPRAQSRAQLDAWQRIQTFFQKYLNGEKPARHSKL", "length": 419, "header": "sp|Q32Q92-1|ACOT6_MOUSE Isoform 1 of Acyl-coenzyme A thioesterase 6 OS=Mus musculus OX=10090 GN=Acot6 PE=1 SV=1 CANONICAL=Q32Q92-1" }, "isoforms": [ { "isoform_ac": "Q32Q92-1", "url": "", "sequence": { "sequence": "MAATLSVEPAGRSCWDEPLSIAVRGLAPEQPVTLRSVLRDEKGMLFRAHARYRADSHGELDLARTPALGGSFSGLEPMGLLWAMEPDRPFWRLIKRDVQIPFVVELEVLDGHEPDGGQRLARAVHERHFMAPGVRRVPVREGRVRATLFLPPGKGQFPGIIDLYGSIGGLCEHRASLLAGHGFAVLALAYFQFEDLPENLSDVRLEYFEEALALMLRHPQVKGPNIGLIGVSKGADLCLSMAAFLKDNITATVLINACVANTLVPLYYKDLFVPELGCDQTKNKSGLMDLRDMWNNPLEEPNHQSLIPLEKAQGPFLFLVGMDDHNWKSDVYARIACERLQAHGKDRPQIIYYPETGHCIEPPYFPPPIATVHFVLGEAVFNGGKPRAQSRAQLDAWQRIQTFFQKYLNGEKPARHSKL", "length": 419, "header": "sp|Q32Q92-1|ACOT6_MOUSE Isoform 1 of Acyl-coenzyme A thioesterase 6 OS=Mus musculus OX=10090 GN=Acot6 PE=1 SV=1 CANONICAL=Q32Q92-1" }, "locus": { "chromosome": "12", "start_pos": 84156310, "end_pos": 84147746, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000056822", "url": "https://www.ensembl.org/id/ENSMUST00000056822" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000056131", "url": "https://www.ensembl.org/id/ENSMUSP00000056131" } ] } }, { "isoform_ac": "Q32Q92-2", "url": "", "sequence": { "sequence": "MAATLSVEPAGRSCWDEPLSIAVRGLAPEQPVTLRSVLRDEKGMLFRAHARYRADSHGELDLARTPALGGSFSGLEPMGLLWAMEPDRPFWRLIKRDVQIPFVVELEVLDGHEPDGGQRLARAVHERHFMAPGVRRVPVREGRVRATLFLPPGEQLSTHLPTRFLSSQPSLFFGPE", "length": 176, "header": "sp|Q32Q92-2|ACOT6_MOUSE Isoform 2 of Acyl-coenzyme A thioesterase 6 OS=Mus musculus OX=10090 GN=Acot6 PE=1 SV=1 CANONICAL=Q32Q92-1" }, "locus": { "chromosome": "12", "start_pos": 84148273, "end_pos": 84147746, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000222921", "url": "https://www.ensembl.org/id/ENSMUST00000222921" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000152129", "url": "https://www.ensembl.org/id/ENSMUSP00000152129" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Peroxisomes contain a specific phytanoyl-CoA/pristanoyl-CoA thioesterase acting as a novel auxiliary enzyme in alpha- and beta-oxidation of methyl-branched fatty acids in mouse.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "Westin MA, Hunt MC, Alexson SE", "evidence": [ { "database": "UniProtKB", "id": "Q32Q92", "url": "https://www.uniprot.org/uniprot/Q32Q92" }, { "database": "RefSeq", "id": "NP_766168", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_766168" } ], "reference": [ { "type": "PubMed", "id": "17613526", "url": "https://glygen.org/publication/PubMed/17613526" } ] } ], "pathway": [ { "id": "mmu:217700", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:217700", "resource": "KEGG Pathway" }, { "id": "R-MMU-390247", "name": "Beta-oxidation of very long chain fatty acids", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-390247", "resource": "Reactome", "description": "Beta-oxidation of very long chain fatty acids" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZSE3-1", "protein_name": "Acyl-CoA thioesterase 6", "gene_name": "Acot6", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAATLTLEPAGRSCWDEPLSIVLSGLAPEQSVTLCSALRDEKGVLFRAHALYRADVQGELNLALAPALGGSFTGLEPMGLIWAMEPERPFWRLIKRDVQTPLVVELEVLDGHEPDGGQRLAQAVHERHFMAPGVRRVPVREGRVRATLFLPPGEGQFSGIIDLYGSIGGLREYRASLLAGHGFAVLALAYFQFEDLPEYLSQVHLEYFEEAVTFMLHHPQVKGPNIGLLGISKGGDLCLSMAAFLKDKITATVLINACVANTLAPLYYKDMFIPNLGYDPTKHKILESGLLDLGDIWNNPLEEPNHQSLISLEKAQGPFLFIVGMDDHSWKSDVYARIASRRLQAHGKDRPQIIYYPKSGHCIDPPYFPPPIAFVPTAVSGPILSGGEPRAQSRAQLDAWQRIQTFFRKYLNGEKPARHSKM", "length": 422 }, "evidence": [ { "id": "45227675", "url": "http://www.informatics.jax.org/homology/45227675", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q3I5F7-1", "protein_name": "Acyl-coenzyme A thioesterase 6", "gene_name": "ACOT6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAATLILEPAGRCCWDEPLRIAVRGLAPEQPVTLRTSLRDEEGALFRAHARYRADARDELDLERAPALGGSFAGLQPMGLLWALEPEKALVRLVKRDVRTPFAVELEVLDGHDTEPGRLLCLAQNKRDFLRPGVRREPVRAGPVRAALFLPPDEGPFPGIIDLFGSSRGLCEYRASLLAGHGFAVLALAYFRFEDLPEDLNDVHLEYFEEAVDFMLQHPKVKGPSIALLGFSKGGDLCLSMASFLKGITATVLINACVANTVAPLHYKDMIIPKLVDDLGKVKITKSGFLTFMDTWSNPLEEHNHQSLVPLEKAQVPFLFIVGMDDQSWKSEFYAQIASERLQAHGKERPQIICYPETGHCIDPPYFPPSRASVHAVLGEAIFYGGEPKAHSKAQVDAWQQIQTFFHKHLNGKKSVKHSKI", "length": 421 }, "evidence": [ { "id": "45227675", "url": "http://www.informatics.jax.org/homology/45227675", "database": "MGI" }, { "id": "Q32Q92", "url": "https://omabrowser.org/oma/group/Q32Q92/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "peroxisome", "id": "GO:0005777", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005777", "evidence": [ { "database": "UniProtKB", "id": "Q32Q92", "url": "https://www.uniprot.org/uniprot/Q32Q92" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q32Q92", "url": "https://www.uniprot.org/uniprot/Q32Q92" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "fatty acid metabolic process", "id": "GO:0006631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006631", "evidence": [ { "database": "UniProtKB", "id": "Q32Q92", "url": "https://www.uniprot.org/uniprot/Q32Q92" } ], "pmid": "" }, { "name": "acyl-CoA metabolic process", "id": "GO:0006637", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006637", "evidence": [ { "database": "UniProtKB", "id": "Q32Q92", "url": "https://www.uniprot.org/uniprot/Q32Q92" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "acyl-CoA hydrolase activity", "id": "GO:0047617", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047617", "evidence": [ { "database": "UniProtKB", "id": "Q32Q92", "url": "https://www.uniprot.org/uniprot/Q32Q92" } ], "pmid": "" }, { "name": "carboxylic ester hydrolase activity", "id": "GO:0052689", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052689", "evidence": [ { "database": "UniProtKB", "id": "Q32Q92", "url": "https://www.uniprot.org/uniprot/Q32Q92" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 199, "end_pos": 201, "annotation": "n_glycosylation_sequon" }, { "start_pos": 248, "end_pos": 250, "annotation": "n_glycosylation_sequon" }, { "start_pos": 283, "end_pos": 285, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "40415", "name": "", "equation": "H2O + pristanoyl-CoA = 2,6,10,14-tetramethylpentadecanoate + CoA + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P16970-1", "P28288-1", "Q3I5F7-1", "Q32Q92-1", "P55096-1" ], "evidence": [ { "id": "40415", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/40415" } ] }, { "id": "40419", "name": "", "equation": "H2O + phytanoyl-CoA = 3,7,11,15-tetramethylhexadecanoate + CoA + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q3I5F7-1", "Q32Q92-1" ], "evidence": [ { "id": "40419", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/40419" } ] }, { "id": "R-MMU-5690042", "name": "Peroxisomal ACOT4,6,8 hydrolyse MCFA-CoA, LCFA-CoA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "peroxisomal matrix", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P58137-1", "Q8BWN8-1", "Q32Q92-1" ], "evidence": [ { "id": "R-MMU-5690042", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5690042" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P16970", "gene_name": "Abcd3", "activity": [ { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "P16970", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16970" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "P16970", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16970" } ] } ] }, { "uniprot_ac": "P28288", "gene_name": "ABCD3", "activity": [ { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "P28288", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28288" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "P28288", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28288" } ] } ] }, { "uniprot_ac": "P55096", "gene_name": "Abcd3", "activity": [ { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "P55096", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55096" } ] }, { "ec_number": "7.6.2.-", "activity": "", "evidence": [ { "id": "P55096", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55096" } ] } ] }, { "uniprot_ac": "P58137", "gene_name": "Acot8", "activity": [ { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "P58137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58137" } ] }, { "ec_number": "3.1.2.27", "activity": "(3S)-hydroxy-3-methylglutaryl-CoA + H2O = 3-hydroxy-3-methylglutarate + CoA + H(+).", "evidence": [ { "id": "P58137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58137" } ] }, { "ec_number": "3.1.2.1", "activity": "acetyl-CoA + H2O = acetate + CoA + H(+).", "evidence": [ { "id": "P58137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58137" } ] }, { "ec_number": "3.1.2.11", "activity": "acetoacetyl-CoA + H2O = acetoacetate + CoA + H(+).", "evidence": [ { "id": "P58137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58137" } ] }, { "ec_number": "3.1.2.3", "activity": "H2O + succinyl-CoA = CoA + H(+) + succinate.", "evidence": [ { "id": "P58137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58137" } ] }, { "ec_number": "3.1.2.5", "activity": "(3S)-hydroxy-3-methylglutaryl-CoA + H2O = 3-hydroxy-3-methylglutarate + CoA + H(+).", "evidence": [ { "id": "P58137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58137" } ] }, { "ec_number": "3.1.2.1", "activity": "", "evidence": [ { "id": "P58137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58137" } ] }, { "ec_number": "3.1.2.3", "activity": "", "evidence": [ { "id": "P58137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58137" } ] }, { "ec_number": "3.1.2.5", "activity": "", "evidence": [ { "id": "P58137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58137" } ] }, { "ec_number": "3.1.2.11", "activity": "", "evidence": [ { "id": "P58137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58137" } ] }, { "ec_number": "3.1.2.2", "activity": "", "evidence": [ { "id": "P58137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58137" } ] } ] }, { "uniprot_ac": "Q32Q92", "gene_name": "Acot6", "activity": [ { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "Q32Q92", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q32Q92" } ] } ] }, { "uniprot_ac": "Q3I5F7", "gene_name": "ACOT6", "activity": [ { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "Q3I5F7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3I5F7" } ] } ] }, { "uniprot_ac": "Q8BWN8", "gene_name": "Acot4", "activity": [ { "ec_number": "3.1.2.3", "activity": "H2O + succinyl-CoA = CoA + H(+) + succinate.", "evidence": [ { "id": "Q8BWN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWN8" } ] }, { "ec_number": "3.1.2.3", "activity": "", "evidence": [ { "id": "Q8BWN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWN8" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }