{ "uniprot_canonical_ac": "Q27869-1", "uniprot_ac": "Q27869", "uniprot_id": "PIMT_DROME", "mass": { "chemical_mass": 24590.0, "monoisotopic_mass": 24590.0 }, "refseq": { "ac": "NP_536756", "name": "Protein-L-isoaspartate (D-aspartate) O-methyltransferase, isoform A", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_536756" }, "gene_names": [ { "name": "Pcmt", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q27869", "id": "Q27869" }, { "name": "CG2152; Dmel\\CG2152; dPIMT; pcmt; PCMT; Pimt; PIMT", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262287", "id": "NP_001262287" }, { "name": "CG2152", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q27869", "id": "Q27869" }, { "name": "Dmel\\CG2152", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q27869", "id": "Q27869" }, { "name": "Dmel_CG2152", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q27869", "id": "Q27869" }, { "name": "PCMT", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q27869", "id": "Q27869" }, { "name": "PIAM", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q27869", "id": "Q27869" }, { "name": "PIMT", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q27869", "id": "Q27869" }, { "name": "Pcmt", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262287", "id": "NP_001262287" }, { "name": "Pimt", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q27869", "id": "Q27869" }, { "name": "dPIMT", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q27869", "id": "Q27869" }, { "name": "pcmt", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q27869", "id": "Q27869" } ], "protein_names": [ { "name": "Protein-L-isoaspartate(D-aspartate) O-methyltransferase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q27869" }, { "name": "2.1.1.77", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q27869" }, { "name": "CG2152-PA; Pcmt-PA; protein D-aspartyl, L-isoaspartyl O-methyltransferase; protein isoaspartyl methyltransferase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_536756", "id": "NP_536756" }, { "name": "CG2152-PC; Pcmt-PC; protein D-aspartyl, L-isoaspartyl O-methyltransferase; protein isoaspartyl methyltransferase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262287", "id": "NP_001262287" }, { "name": "L-isoaspartyl protein carboxyl methyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q27869" }, { "name": "PIMT", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q27869" }, { "name": "Protein L-isoaspartyl/D-aspartyl methyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q27869" }, { "name": "Protein-L-isoaspartate (D-aspartate) O-methyltransferase, isoform A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_536756", "id": "NP_536756" }, { "name": "Protein-L-isoaspartate (D-aspartate) O-methyltransferase, isoform C", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001262287", "id": "NP_001262287" }, { "name": "Protein-beta-aspartate methyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q27869" }, { "name": "dPIMT", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q27869" } ], "function": [ { "annotation": "Initiates the repair of damaged proteins by catalyzing methyl esterification of L-isoaspartyl and D-aspartyl residues produced by spontaneous isomerization and racemization of L-aspartyl and L-asparaginyl residues in aging peptides and proteins.", "evidence": [ { "database": "UniProtKB", "id": "Q27869", "url": "https://www.uniprot.org/uniprot/Q27869#function" }, { "database": "PubMed", "id": "9061928", "url": "https://glygen.org/publication/PubMed/9061928" }, { "database": "PubMed", "id": "14596598", "url": "https://glygen.org/publication/PubMed/14596598" } ] } ], "disease": [ { "disease_id": "DOID:10652", "recommended_name": { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer's disease", "description": "A tauopathy that is characterized by memory lapses, confusion, emotional instability and progressive loss of mental ability and results in progressive memory loss, impaired thinking, disorientation, and changes in personality and mood starting and leads in advanced cases to a profound decline in cognitive and physical functioning and is marked histologically by the degeneration of brain neurons especially in the cerebral cortex and by the presence of neurofibrillary tangles and plaques containing beta-amyloid." }, "synonyms": [ { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer disease", "description": "" }, { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimers dementia", "description": "" } ], "evidence": [ { "id": "10652", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10652" } ] }, { "disease_id": "DOID:3069", "recommended_name": { "id": "DOID:3069", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3069", "name": "malignant astrocytoma", "description": "A malignant glioma that is has_material_basis_in astrocyte cells, a type of star-shaped glial cell, located in the brain and spinal cord." }, "synonyms": [ { "id": "DOID:3069", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3069", "name": "Astrocytic tumor", "description": "" }, { "id": "DOID:3069", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3069", "name": "astrocytoma of Cerebrum", "description": "" }, { "id": "DOID:3069", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3069", "name": "astrocytoma of brain", "description": "" }, { "id": "DOID:3069", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3069", "name": "astroglioma", "description": "" }, { "id": "DOID:3069", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3069", "name": "cerebral astrocytoma", "description": "" } ], "evidence": [ { "id": "3069", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3069" } ] }, { "disease_id": "DOID:3070", "recommended_name": { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "high grade glioma", "description": "A cell type cancer that has_material_basis_in glial cells and is located in brain or located in spine." }, "synonyms": [ { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "malignant glioma", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "Neuroglial tumor", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "glial cell tumor", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "glioma, malignant", "description": "" }, { "id": "DOID:3070", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3070", "name": "malignant Neuroglial tumor", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma susceptibility 1", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "GLM1", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioblastoma, somatic", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma susceptibility 1", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma susceptibility 1, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma, susceptibility to, somatic", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "astrocytoma", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "ependymoma", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioblastoma multiforme", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "glioma of brain, familial", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "oligodendroglioma", "description": "" }, { "id": "MONDO:0024498", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024498", "name": "subependymoma", "description": "" }, { "id": "MIM:137800", "resource": "MIM", "url": "https://www.omim.org/entry/137800", "name": "Glioma 1", "description": "Glioma 1" } ], "evidence": [ { "id": "3070", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3070" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 60, "end_pos": 60, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduces catalytic efficiency.", "evidence": [ { "database": "UniProtKB", "id": "Q27869", "url": "https://www.uniprot.org/uniprot/Q27869" }, { "database": "PubMed", "id": "14596598", "url": "https://glygen.org/publication/PubMed/14596598" } ] }, { "start_pos": 60, "end_pos": 60, "sequence_org": "S", "sequence_mut": "Q", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q27869", "url": "https://www.uniprot.org/uniprot/Q27869" }, { "database": "PubMed", "id": "14596598", "url": "https://glygen.org/publication/PubMed/14596598" } ] }, { "start_pos": 60, "end_pos": 60, "sequence_org": "S", "sequence_mut": "T", "comment": "Reduces catalytic efficiency.", "evidence": [ { "database": "UniProtKB", "id": "Q27869", "url": "https://www.uniprot.org/uniprot/Q27869" }, { "database": "PubMed", "id": "14596598", "url": "https://glygen.org/publication/PubMed/14596598" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q27869", "url": "https://www.uniprot.org/uniprot/Q27869" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "Pcmt", "url": "https://www.uniprot.org/uniprot/Q27869", "locus": { "chromosome": "3R", "start_pos": 5552823, "end_pos": 5554316, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0086768", "url": "https://www.ensembl.org/id/FBgn0086768" } ] } } ], "crossref": [ { "id": "FBgn0086768", "url": "https://bgee.org/?page=gene&gene_id=FBgn0086768", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "2.1.1.77", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.1.1.77&UniProtAcc=Q27869", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd02440", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02440", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "FBgn0086768", "url": "https://flybase.org/reports/FBgn0086768", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "40668", "url": "https://www.ncbi.nlm.nih.gov/gene/40668", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000682", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000682", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029063", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029063", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG2152", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG2152", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "TISAIHM", "url": "https://omabrowser.org/oma/group/TISAIHM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "303909at2759", "url": "http://www.orthodb.org/?query=303909at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11579", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11579", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11579:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11579:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1R18", "url": "https://www.rcsb.org/structure/1R18", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01135", "url": "http://pfam.xfam.org/family/PF01135", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q27869", "url": "http://purl.obolibrary.org/obo/PR_Q27869", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-DME-5676934", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5676934", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_536756", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_536756", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "12705", "url": "https://www.rhea-db.org/rhea/12705", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A0B4KGK0", "url": "https://www.uniprot.org/uniprot/A0A0B4KGK0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0B4KGK0-1", "url": "https://www.uniprot.org/uniprot/A0A0B4KGK0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q27869", "url": "https://www.uniprot.org/uniprot/Q27869", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q27869-1", "url": "https://www.uniprot.org/uniprot/Q27869-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTISAPHMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQYMQQYDKDANGKVEMTRLMGVMYVPLTDLRS", "length": 226, "header": "sp|Q27869-1|PIMT_DROME Isoform 1 of Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Pcmt PE=1 SV=2 CANONICAL=Q27869-1" }, "isoforms": [ { "isoform_ac": "A0A0B4KGK0-1", "url": "", "sequence": { "sequence": "MAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTISAPHMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQYMQQVGRC", "length": 203, "header": "tr|A0A0B4KGK0-1|PIMT_DROME Computationally mapped isoform of Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Pcmt PE=1 SV=1 CANONICAL=Q27869-1" }, "locus": { "chromosome": "3R", "start_pos": 5554183, "end_pos": 5553259, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0339519", "url": "https://www.ensembl.org/id/FBtr0339519" }, { "database": "Ensembl Peptide", "id": "FBpp0308602", "url": "https://www.ensembl.org/id/FBpp0308602" } ] } }, { "isoform_ac": "Q27869-1", "url": "", "sequence": { "sequence": "MAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTISAPHMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQYMQQYDKDANGKVEMTRLMGVMYVPLTDLRS", "length": 226, "header": "sp|Q27869-1|PIMT_DROME Isoform 1 of Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Pcmt PE=1 SV=2 CANONICAL=Q27869-1" }, "locus": { "chromosome": "3R", "start_pos": 5554183, "end_pos": 5552965, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0078758", "url": "https://www.ensembl.org/id/FBtr0078758" }, { "database": "Ensembl Peptide", "id": "FBpp0078405", "url": "https://www.ensembl.org/id/FBpp0078405" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KGK0", "url": "https://www.uniprot.org/uniprot/A0A0B4KGK0" }, { "database": "UniProtKB", "id": "Q27869", "url": "https://www.uniprot.org/uniprot/Q27869" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.", "journal": "Genome Biol.", "date": "2002", "authors": "Celniker SE, Wheeler DA, Kronmiller B, Carlson JW, Halpern A, Patel S, Adams M, Champe M, Dugan SP, Frise E, Hodgson A, George RA, Hoskins RA, Laverty T, Muzny DM, Nelson CR, Pacleb JM, Park S, Pfeiffer BD, Richards S, Sodergren EJ, Svirskas R, Tabor PE, Wan K, Stapleton M, Sutton GG, Venter C, Weinstock G, Scherer SE, Myers EW, Gibbs RA, Rubin GM", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KGK0", "url": "https://www.uniprot.org/uniprot/A0A0B4KGK0" } ], "reference": [ { "type": "PubMed", "id": "12537568", "url": "https://glygen.org/publication/PubMed/12537568" } ] }, { "title": "A Drosophila full-length cDNA resource.", "journal": "Genome Biol.", "date": "2002", "authors": "Stapleton M, Carlson J, Brokstein P, Yu C, Champe M, George R, Guarin H, Kronmiller B, Pacleb J, Park S, Wan K, Rubin GM, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q27869", "url": "https://www.uniprot.org/uniprot/Q27869" } ], "reference": [ { "type": "PubMed", "id": "12537569", "url": "https://glygen.org/publication/PubMed/12537569" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KGK0", "url": "https://www.uniprot.org/uniprot/A0A0B4KGK0" }, { "database": "UniProtKB", "id": "Q27869", "url": "https://www.uniprot.org/uniprot/Q27869" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.", "journal": "Genome Biol.", "date": "2002", "authors": "Kaminker JS, Bergman CM, Kronmiller B, Carlson J, Svirskas R, Patel S, Frise E, Wheeler DA, Lewis SE, Rubin GM, Ashburner M, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KGK0", "url": "https://www.uniprot.org/uniprot/A0A0B4KGK0" } ], "reference": [ { "type": "PubMed", "id": "12537573", "url": "https://glygen.org/publication/PubMed/12537573" } ] }, { "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.", "journal": "Genome Biol.", "date": "2002", "authors": "Hoskins RA, Smith CD, Carlson JW, Carvalho AB, Halpern A, Kaminker JS, Kennedy C, Mungall CJ, Sullivan BA, Sutton GG, Yasuhara JC, Wakimoto BT, Myers EW, Celniker SE, Rubin GM, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KGK0", "url": "https://www.uniprot.org/uniprot/A0A0B4KGK0" } ], "reference": [ { "type": "PubMed", "id": "12537574", "url": "https://glygen.org/publication/PubMed/12537574" } ] }, { "title": "Catalytic implications from the Drosophila protein L-isoaspartyl methyltransferase structure and site-directed mutagenesis.", "journal": "Biochemistry", "date": "2003", "authors": "Bennett EJ, Bjerregaard J, Knapp JE, Chavous DA, Friedman AM, Royer WE Jr, O'Connor CM", "evidence": [ { "database": "UniProtKB", "id": "Q27869", "url": "https://www.uniprot.org/uniprot/Q27869" } ], "reference": [ { "type": "PubMed", "id": "14596598", "url": "https://glygen.org/publication/PubMed/14596598" } ] }, { "title": "Combined evidence annotation of transposable elements in genome sequences.", "journal": "PLoS Comput. Biol.", "date": "2005", "authors": "Quesneville H, Bergman CM, Andrieu O, Autard D, Nouaud D, Ashburner M, Anxolabehere D", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KGK0", "url": "https://www.uniprot.org/uniprot/A0A0B4KGK0" } ], "reference": [ { "type": "PubMed", "id": "16110336", "url": "https://glygen.org/publication/PubMed/16110336" } ] }, { "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Smith CD, Shu S, Mungall CJ, Karpen GH", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KGK0", "url": "https://www.uniprot.org/uniprot/A0A0B4KGK0" } ], "reference": [ { "type": "PubMed", "id": "17569856", "url": "https://glygen.org/publication/PubMed/17569856" } ] }, { "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.", "journal": "Science", "date": "2007", "authors": "Hoskins RA, Carlson JW, Kennedy C, Acevedo D, Evans-Holm M, Frise E, Wan KH, Park S, Mendez-Lago M, Rossi F, Villasante A, Dimitri P, Karpen GH, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "A0A0B4KGK0", "url": "https://www.uniprot.org/uniprot/A0A0B4KGK0" } ], "reference": [ { "type": "PubMed", "id": "17569867", "url": "https://glygen.org/publication/PubMed/17569867" } ] }, { "title": "Structural organization and developmental expression of the protein isoaspartyl methyltransferase gene from Drosophila melanogaster.", "journal": "Insect Biochem. Mol. Biol.", "date": "1997", "authors": "O'Connor C.M., Jackson F.R., O'Connor M.B., Galus A., Hartenstine M., Magee M.", "evidence": [ { "database": "UniProtKB", "id": "Q27869", "url": "https://www.uniprot.org/uniprot/Q27869" } ], "reference": [ { "type": "PubMed", "id": "9061928", "url": "https://glygen.org/publication/PubMed/9061928" } ] } ], "pathway": [ { "id": "dme:Dmel_CG2152", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG2152", "resource": "KEGG Pathway" }, { "id": "R-DME-5676934", "name": "Protein repair", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5676934", "resource": "Reactome", "description": "Protein repair" } ], "orthologs": [ { "uniprot_canonical_ac": "P22061-1", "protein_name": "Protein-L-isoaspartate(D-aspartate) O-methyltransferase", "gene_name": "PCMT1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSRWK", "length": 227 }, "evidence": [ { "id": "Q27869", "url": "https://omabrowser.org/oma/group/Q27869/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "protein modification process", "id": "GO:0036211", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036211", "evidence": [ { "database": "UniProtKB", "id": "Q27869", "url": "https://www.uniprot.org/uniprot/Q27869" } ], "pmid": "" }, { "name": "methylation", "id": "GO:0032259", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032259", "evidence": [ { "database": "UniProtKB", "id": "Q27869", "url": "https://www.uniprot.org/uniprot/Q27869" } ], "pmid": "" }, { "name": "defense response to bacterium", "id": "GO:0042742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042742", "evidence": [ { "database": "UniProtKB", "id": "Q27869", "url": "https://www.uniprot.org/uniprot/Q27869" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "protein-L-isoaspartate (D-aspartate) O-methyltransferase activity", "id": "GO:0004719", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004719", "evidence": [ { "database": "UniProtKB", "id": "Q27869", "url": "https://www.uniprot.org/uniprot/Q27869" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q27869", "url": "https://www.uniprot.org/uniprot/Q27869" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q27869", "url": "https://www.uniprot.org/uniprot/Q27869" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "12705", "name": "", "equation": "[protein]-L-isoaspartate + S-adenosyl-L-methionine = [protein]-L-isoaspartate alpha-methyl ester + S-adenosyl-L-homocysteine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P22062-1", "P22061-1", "P23506-1", "Q9GPS6-1", "Q27869-1" ], "evidence": [ { "id": "12705", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/12705" } ] }, { "id": "R-DME-5676966", "name": "PCMT1 transfers CH3 from AdoMet to isoAsp to form MetAsp", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-5687536" ], "output_participant_list": [ "R-ALL-5687529" ], "enzyme_list": [ "Q27869-1" ], "evidence": [ { "id": "R-DME-5676966", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-DME-5676966" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-5687529", "participant_name": "MetAsp [cytosol]", "crossref": [ { "id": "31882", "database": "ChEBI", "url": "" }, { "id": "HMDB0002393", "database": "HMDB Metabolite", "url": "" }, { "id": "000000901012", "database": "ZINC", "url": "" }, { "id": "C12269", "database": "COMPOUND", "url": "" }, { "id": "31882", "database": "ChEBI", "url": "" }, { "id": "HMDB0002393", "database": "HMDB Metabolite", "url": "" }, { "id": "000000901012", "database": "ZINC", "url": "" }, { "id": "C12269", "database": "COMPOUND", "url": "" }, { "id": "31882", "database": "ChEBI", "url": "" }, { "id": "HMDB0002393", "database": "HMDB Metabolite", "url": "" }, { "id": "000000901012", "database": "ZINC", "url": "" }, { "id": "C12269", "database": "COMPOUND", "url": "" }, { "id": "C12269", "database": "COMPOUND", "url": "" }, { "id": "HMDB0002393", "database": "HMDB Metabolite", "url": "" }, { "id": "31882", "database": "ChEBI", "url": "" }, { "id": "000000901012", "database": "ZINC", "url": "" }, { "id": "31882", "database": "ChEBI", "url": "" }, { "id": "HMDB0002393", "database": "HMDB Metabolite", "url": "" }, { "id": "000000901012", "database": "ZINC", "url": "" }, { "id": "C12269", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-5687536", "participant_name": "isoAsp [cytosol]", "crossref": [ { "id": "90596", "database": "ChEBI", "url": "" }, { "id": "90596", "database": "ChEBI", "url": "" }, { "id": "90596", "database": "ChEBI", "url": "" }, { "id": "90596", "database": "ChEBI", "url": "" }, { "id": "90596", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P22061", "gene_name": "PCMT1", "activity": [ { "ec_number": "2.1.1.77", "activity": "[protein]-L-isoaspartate + S-adenosyl-L-methionine = [protein]-L-isoaspartate alpha-methyl ester + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P22061", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22061" } ] }, { "ec_number": "2.1.1.77", "activity": "", "evidence": [ { "id": "P22061", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22061" } ] } ] }, { "uniprot_ac": "P22062", "gene_name": "Pcmt1", "activity": [ { "ec_number": "2.1.1.77", "activity": "[protein]-L-isoaspartate + S-adenosyl-L-methionine = [protein]-L-isoaspartate alpha-methyl ester + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P22062", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22062" } ] }, { "ec_number": "2.1.1.77", "activity": "", "evidence": [ { "id": "P22062", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22062" } ] } ] }, { "uniprot_ac": "P23506", "gene_name": "Pcmt1", "activity": [ { "ec_number": "2.1.1.77", "activity": "[protein]-L-isoaspartate + S-adenosyl-L-methionine = [protein]-L-isoaspartate alpha-methyl ester + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P23506", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23506" } ] }, { "ec_number": "2.1.1.77", "activity": "", "evidence": [ { "id": "P23506", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23506" } ] } ] }, { "uniprot_ac": "Q27869", "gene_name": "Pcmt", "activity": [ { "ec_number": "2.1.1.77", "activity": "[protein]-L-isoaspartate + S-adenosyl-L-methionine = [protein]-L-isoaspartate alpha-methyl ester + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q27869", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q27869" } ] }, { "ec_number": "2.1.1.77", "activity": "", "evidence": [ { "id": "Q27869", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q27869" } ] } ] }, { "uniprot_ac": "Q9GPS6", "gene_name": "pcmA", "activity": [ { "ec_number": "2.1.1.77", "activity": "[protein]-L-isoaspartate + S-adenosyl-L-methionine = [protein]-L-isoaspartate alpha-methyl ester + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9GPS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9GPS6" } ] }, { "ec_number": "2.1.1.77", "activity": "", "evidence": [ { "id": "Q9GPS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9GPS6" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }