{ "uniprot_canonical_ac": "Q1HCM0-1", "uniprot_ac": "Q1HCM0", "uniprot_id": "FGFP3_MOUSE", "mass": { "chemical_mass": 26217.0, "monoisotopic_mass": 26217.0 }, "refseq": { "ac": "NP_082539", "name": "fibroblast growth factor-binding protein 3 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082539" }, "gene_names": [ { "name": "Fgfbp3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q1HCM0", "id": "Q1HCM0" }, { "name": "2610306H15Rik; Fgf-bp3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082539", "id": "NP_082539" }, { "name": "Fgfbp3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082539", "id": "NP_082539" } ], "protein_names": [ { "name": "Fibroblast growth factor-binding protein 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q1HCM0" }, { "name": "FGF-BP3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q1HCM0" }, { "name": "FGF-binding protein 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q1HCM0" }, { "name": "FGFBP-3; FGF-binding protein 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082539", "id": "NP_082539" }, { "name": "FGFBP-3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q1HCM0" }, { "name": "fibroblast growth factor-binding protein 3 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082539", "id": "NP_082539" } ], "function": [ { "annotation": "Heparin-binding protein which binds to FGF2, prevents binding of FGF2 to heparin and probably inhibits immobilization of FGF2 on extracellular matrix glycosaminoglycans, allowing its release and subsequent activation of FGFR signaling which leads to increased vascular permeability.", "evidence": [ { "database": "UniProtKB", "id": "Q1HCM0", "url": "https://www.uniprot.org/uniprot/Q1HCM0#function" }, { "database": "UniProtKB", "id": "Q8TAT2", "url": "https://www.uniprot.org/uniprot/Q8TAT2#function" } ] }, { "annotation": "These results demonstrate that FGF-BP3 is a potent mediator of anxiety-related behaviors in mice and suggest that distinct pathways regulate emotional behaviors.", "evidence": [ { "database": "RefSeq", "id": "NP_082539", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082539" }, { "database": "PubMed", "id": "20851768", "url": "https://glygen.org/publication/PubMed/20851768" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q1HCM0", "url": "https://www.uniprot.org/uniprot/Q1HCM0" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Fgfbp3", "url": "https://www.uniprot.org/uniprot/Q1HCM0", "locus": { "chromosome": "19", "start_pos": 36894950, "end_pos": 36897015, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000047632", "url": "https://www.ensembl.org/id/ENSMUSG00000047632" } ] } } ], "crossref": [ { "id": "ENSMUSG00000047632", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000047632", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "72514", "url": "https://www.ncbi.nlm.nih.gov/gene/72514", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR010510", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010510", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:72514", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:72514", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1919764", "url": "http://www.informatics.jax.org/marker/MGI:1919764", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "CAYRGEP", "url": "https://omabrowser.org/oma/group/CAYRGEP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4338286at2759", "url": "http://www.orthodb.org/?query=4338286at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15258", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15258", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15258:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15258:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF06473", "url": "http://pfam.xfam.org/family/PF06473", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q1HCM0", "url": "http://purl.obolibrary.org/obo/PR_Q1HCM0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-190377", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-190377", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_082539", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082539", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0R4J0R6", "url": "https://www.uniprot.org/uniprot/A0A0R4J0R6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0R4J0R6-1", "url": "https://www.uniprot.org/uniprot/A0A0R4J0R6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q1HCM0", "url": "https://www.uniprot.org/uniprot/Q1HCM0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q1HCM0-1", "url": "https://www.uniprot.org/uniprot/Q1HCM0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSPPRPRASLSPLTLLLLLGGCLLSAAGRDKGAAGREVTRASRPTVGSSGRFVSPEQHACSWQLLVPAPGTPTGGELALRCQTPGGASLHCAYRGHPERCAATGARRAHYWRRLLGALRRRPRPCLDPAPLPPRLCARKTAGSDLHSPAHPSLPARPSEPPRSRARSPARSRQSVRSPSSQPEKKPLLVKSNSGGRKAGSDPVPEPPAAAGFQPNGLDQNAELTETYCTEKWHSLCNFFVNFWNG", "length": 245, "header": "sp|Q1HCM0-1|FGFP3_MOUSE Isoform 1 of Fibroblast growth factor-binding protein 3 OS=Mus musculus OX=10090 GN=Fgfbp3 PE=1 SV=2 CANONICAL=Q1HCM0-1" }, "isoforms": [ { "isoform_ac": "A0A0R4J0R6-1", "url": "", "sequence": { "sequence": "MANAGMSPPRPRASLSPLTLLLLLGGCLLSAAGRDKGAAGREVTRASRPTVGSSGRFVSPEQHACSWQLLVPAPGTPTGGELALRCQTPGGASLHCAYRGHPERCAATGARRAHYWRRLLGALRRRPRPCLDPAPLPPRLCARKTAGSDLHSPAHPSLPARPSEPPRSRARSPARSRQSVRSPSSQPEKKPLLVKSNSGGRKAGSDPVPEPPAAAGFQPNGLDQNAELTETYCTEKWHSLCNFFVNFWNG", "length": 250, "header": "tr|A0A0R4J0R6-1|A0A0R4J0R6_MOUSE Computationally mapped isoform of Fibroblast growth factor binding protein 3 OS=Mus musculus OX=10090 GN=Fgfbp3 PE=3 SV=1 CANONICAL=Q1HCM0-1" }, "locus": { "chromosome": "19", "start_pos": 36896616, "end_pos": 36895867, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000238948.2", "url": "https://www.ensembl.org/id/ENSMUST00000238948.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000159137.2", "url": "https://www.ensembl.org/id/ENSMUSP00000159137.2" } ] } }, { "isoform_ac": "Q1HCM0-1", "url": "", "sequence": { "sequence": "MSPPRPRASLSPLTLLLLLGGCLLSAAGRDKGAAGREVTRASRPTVGSSGRFVSPEQHACSWQLLVPAPGTPTGGELALRCQTPGGASLHCAYRGHPERCAATGARRAHYWRRLLGALRRRPRPCLDPAPLPPRLCARKTAGSDLHSPAHPSLPARPSEPPRSRARSPARSRQSVRSPSSQPEKKPLLVKSNSGGRKAGSDPVPEPPAAAGFQPNGLDQNAELTETYCTEKWHSLCNFFVNFWNG", "length": 245, "header": "sp|Q1HCM0-1|FGFP3_MOUSE Isoform 1 of Fibroblast growth factor-binding protein 3 OS=Mus musculus OX=10090 GN=Fgfbp3 PE=1 SV=2 CANONICAL=Q1HCM0-1" }, "locus": { "chromosome": "19", "start_pos": 36896601, "end_pos": 36895867, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000057337", "url": "https://www.ensembl.org/id/ENSMUST00000057337" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000059682", "url": "https://www.ensembl.org/id/ENSMUSP00000059682" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Inactivation of fibroblast growth factor binding protein 3 causes anxiety-related behaviors.", "journal": "Mol. Cell. Neurosci.", "date": "2011", "authors": "Yamanaka Y, Kitano A, Takao K, Prasansuklab A, Mushiroda T, Yamazaki K, Kumada T, Shibata M, Takaoka Y, Awaya T, Kato T, Abe T, Iwata N, Miyakawa T, Nakamura Y, Nakahata T, Heike T", "evidence": [ { "database": "UniProtKB", "id": "Q1HCM0", "url": "https://www.uniprot.org/uniprot/Q1HCM0" }, { "database": "RefSeq", "id": "NP_082539", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082539" } ], "reference": [ { "type": "PubMed", "id": "20851768", "url": "https://glygen.org/publication/PubMed/20851768" } ] } ], "pathway": [ { "id": "mmu:72514", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:72514", "resource": "KEGG Pathway" }, { "id": "R-MMU-190377", "name": "FGFR2b ligand binding and activation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-190377", "resource": "Reactome", "description": "FGFR2b ligand binding and activation" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZVI0-1", "protein_name": "Fibroblast growth factor binding protein 3", "gene_name": "Fgfbp3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MANAGVSPPRPRASLSPLSLLLLLGGCFLSAAGRDKGAAGREVARASGPRDGSLGRFVSPEQHACSWQLLVPAPGTPTGGELALRCQVPGGASLHCTYRGYPERCAATGSRSAHYWKRLLGALRRRPRPCLDTAPLPPRLCAHKTASAELHPPAHSSLPARPSEEPRPRVRSRARPRQSVRSPSSQPEKKPLLVKSNSGGRKAGSDPVPETPEAVGLQPNGLDQNAELTETYCTEKWHSLCNFFVNFWNG", "length": 250 }, "evidence": [ { "id": "45239302", "url": "http://www.informatics.jax.org/homology/45239302", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8TAT2-1", "protein_name": "Fibroblast growth factor-binding protein 3", "gene_name": "FGFBP3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTPPKLRASLSPSLLLLLSGCLLAAARREKGAASNVAEPVPGPTGGSSGRFLSPEQHACSWQLLLPAPEAAAGSELALRCQSPDGARHQCAYRGHPERCAAYAARRAHFWKQVLGGLRKKRRPCHDPAPLQARLCAGKKGHGAELRLVPRASPPARPTVAGFAGESKPRARNRGRTRERASGPAAGTPPPQSAPPKENPSERKTNEGKRKAALVPNEERPMGTGPDPDGLDGNAELTETYCAEKWHSLCNFFVNFWNG", "length": 258 }, "evidence": [ { "id": "45239302", "url": "http://www.informatics.jax.org/homology/45239302", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q1HCM0", "url": "https://www.uniprot.org/uniprot/Q1HCM0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "cell-cell signaling", "id": "GO:0007267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007267", "evidence": [ { "database": "UniProtKB", "id": "Q1HCM0", "url": "https://www.uniprot.org/uniprot/Q1HCM0" } ], "pmid": "" }, { "name": "adult behavior", "id": "GO:0030534", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030534", "evidence": [ { "database": "UniProtKB", "id": "Q1HCM0", "url": "https://www.uniprot.org/uniprot/Q1HCM0" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "Q1HCM0", "url": "https://www.uniprot.org/uniprot/Q1HCM0" } ], "pmid": "" }, { "name": "positive regulation of vascular permeability", "id": "GO:0043117", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043117", "evidence": [ { "database": "UniProtKB", "id": "Q1HCM0", "url": "https://www.uniprot.org/uniprot/Q1HCM0" } ], "pmid": "" }, { "name": "positive regulation of nervous system process", "id": "GO:0031646", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031646", "evidence": [ { "database": "UniProtKB", "id": "Q1HCM0", "url": "https://www.uniprot.org/uniprot/Q1HCM0" } ], "pmid": "" }, { "name": "positive regulation of fibroblast growth factor receptor signaling pathway", "id": "GO:0045743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045743", "evidence": [ { "database": "UniProtKB", "id": "Q1HCM0", "url": "https://www.uniprot.org/uniprot/Q1HCM0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "heparin binding", "id": "GO:0008201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008201", "evidence": [ { "database": "UniProtKB", "id": "Q1HCM0", "url": "https://www.uniprot.org/uniprot/Q1HCM0" } ], "pmid": "" }, { "name": "growth factor binding", "id": "GO:0019838", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019838", "evidence": [ { "database": "UniProtKB", "id": "Q1HCM0", "url": "https://www.uniprot.org/uniprot/Q1HCM0" } ], "pmid": "" }, { "name": "fibroblast growth factor binding", "id": "GO:0017134", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017134", "evidence": [ { "database": "UniProtKB", "id": "Q1HCM0", "url": "https://www.uniprot.org/uniprot/Q1HCM0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }