{
"uniprot_canonical_ac": "Q16842-1",
"uniprot_ac": "Q16842",
"uniprot_id": "SIA4B_HUMAN",
"mass": {
"chemical_mass": 40173.0,
"monoisotopic_mass": 40173.0
},
"refseq": {
"ac": "NP_008858",
"name": "CMP-N-acetylneuraminate-beta-galactosamide- alpha-2,3-sialyltransferase 2",
"summary": "The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A. [provided by RefSeq, Jul 2008].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_008858"
},
"gene_names": [
{
"name": "ST3GAL2",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/Q16842",
"id": "Q16842"
},
{
"name": "Gal-NAc6S; SIAT4B; ST3GalA.2; ST3GALII",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_008858",
"id": "NP_008858"
},
{
"name": "SIAT4B",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/Q16842",
"id": "Q16842"
},
{
"name": "ST3GAL2",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_008858",
"id": "NP_008858"
}
],
"protein_names": [
{
"name": "CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "Q16842"
},
{
"name": "2.4.3.2",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "Q16842"
},
{
"name": "2.4.3.4",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "Q16842"
},
{
"name": "Alpha 2,3-ST 2",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "Q16842"
},
{
"name": "Beta-galactoside alpha-2,3-sialyltransferase 2",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "Q16842"
},
{
"name": "CMP-N-acetylneuraminate-beta-galactosamide- alpha-2,3-sialyltransferase 2",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_008858",
"id": "NP_008858"
},
{
"name": "Gal-NAc6S",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "Q16842"
},
{
"name": "Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "Q16842"
},
{
"name": "Monosialoganglioside sialyltransferase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "Q16842"
},
{
"name": "SIAT4-B",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "Q16842"
},
{
"name": "ST3Gal II",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "Q16842"
},
{
"name": "ST3GalA.2",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "Q16842"
},
{
"name": "ST3GalII",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "Q16842"
},
{
"name": "Sialyltransferase 4B",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "Q16842"
},
{
"name": "sialyltransferase 4B (beta-galactosidase alpha-2,3-sialytransferase); Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase; SIAT4-B; ST3Gal II; alpha 2,3-ST 2; monosialoganglioside sialyltransferase; beta-galactoside alpha-2,3-sialyltransferase 2",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_008858",
"id": "NP_008858"
}
],
"function": [
{
"annotation": "A beta-galactoside alpha2-3 sialyltransferase primarily involved in terminal sialylation of ganglio and globo series glycolipids (PubMed:8920913, PubMed:9266697). Catalyzes the transfer of sialic acid (N-acetyl-neuraminic acid; Neu5Ac) from the nucleotide sugar donor CMP-Neu5Ac onto acceptor Galbeta-(1->3)-GalNAc-terminated glycoconjugates through an alpha2-3 linkage (PubMed:8920913, PubMed:9266697, PubMed:25916169). Sialylates GM1/GM1a, GA1/asialo-GM1 and GD1b gangliosides to form GD1a, GM1b and GT1b, respectively (PubMed:8920913, PubMed:9266697). Together with ST3GAL3, primarily responsible for biosynthesis of brain GD1a and GT1b that function as ligands for myelin-associated glycoprotein MAG on axons, regulating MAG expression and axonal myelin stability and regeneration (By similarity). Via GT1b regulates TLR2 signaling in spinal cord microglia in response to nerve injury (By similarity). Responsible for the sialylation of the pluripotent stem cell- and cancer stem cell-associated antigen SSEA3, forming SSEA4 (PubMed:12716912). Sialylates with low efficiency asialofetuin, presumably onto O-glycosidically linked Galbeta-(1->3)-GalNAc-O-Ser (PubMed:9266697, PubMed:25916169).",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842#function"
},
{
"database": "PubMed",
"id": "8920913",
"url": "https://glygen.org/publication/PubMed/8920913"
},
{
"database": "UniProtKB",
"id": "Q11204",
"url": "https://www.uniprot.org/uniprot/Q11204#function"
},
{
"database": "PubMed",
"id": "9266697",
"url": "https://glygen.org/publication/PubMed/9266697"
},
{
"database": "PubMed",
"id": "12716912",
"url": "https://glygen.org/publication/PubMed/12716912"
},
{
"database": "PubMed",
"id": "25916169",
"url": "https://glygen.org/publication/PubMed/25916169"
}
]
},
{
"annotation": "Data suggest that ganglioside glycosyltransferases ST3GAL5, ST8SIA1, and B4GALNT1 are S-acylated at conserved cysteine residues located close to cytoplasmic border of their transmembrane domains; ST3Gal-II is acylated at conserved cysteine residue in N-terminal cytoplasmic tail; for B4GALNT1 and ST3Gal-II, dimer formation controls their S-acylation status. Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_008858",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_008858"
},
{
"database": "PubMed",
"id": "28698248",
"url": "https://glygen.org/publication/PubMed/28698248"
}
]
},
{
"annotation": "Genomic structure, expression, and transcriptional regulation of ST3GALII.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_008858",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_008858"
},
{
"database": "PubMed",
"id": "12504121",
"url": "https://glygen.org/publication/PubMed/12504121"
}
]
},
{
"annotation": "Overlapping and unique substrate specificities of ST3GAL1 and 2 during hematopoietic and megakaryocytic differentiation.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_008858",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_008858"
},
{
"database": "PubMed",
"id": "35507766",
"url": "https://glygen.org/publication/PubMed/35507766"
}
]
},
{
"annotation": "ST3Gal II is a MSGb5 (stage-specific embryonic antigen-4) synthase and its increased expression level is closely related to renal carcinogenesis",
"evidence": [
{
"database": "RefSeq",
"id": "NP_008858",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_008858"
},
{
"database": "PubMed",
"id": "12716912",
"url": "https://glygen.org/publication/PubMed/12716912"
}
]
},
{
"annotation": "The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A. [provided by RefSeq, Jul 2008].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_008858",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_008858"
}
]
},
{
"annotation": "This suggests that the C-terminal domain of ST3Gal-II depends on N-glycosylation to attain an optimum conformation for proper exit from the endoplasmic reticulum",
"evidence": [
{
"database": "RefSeq",
"id": "NP_008858",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_008858"
},
{
"database": "PubMed",
"id": "25916169",
"url": "https://glygen.org/publication/PubMed/25916169"
}
]
}
],
"disease": [],
"snv": [
{
"evidence": [
{
"id": "rs754309990",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754309990"
},
{
"id": "rs754309990",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754309990"
},
{
"id": "rs754309990",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs754309990#frequency_tab"
},
{
"id": "rs754309990",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs754309990"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"o-glyco-site-loss"
],
"start_pos": 193,
"end_pos": 193,
"sequence_org": "S",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SRT->NRT).",
"chr_id": "16",
"chr_pos": "70388502",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "S193",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1402721752",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1402721752"
},
{
"id": "rs1402721752",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1402721752#frequency_tab"
},
{
"id": "rs1402721752",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs1402721752"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 209,
"end_pos": 209,
"sequence_org": "P",
"sequence_mut": "S",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLP->NLS).",
"chr_id": "16",
"chr_pos": "70388455",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "P209",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs757729789",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757729789"
},
{
"id": "rs757729789",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757729789"
},
{
"id": "rs757729789",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs757729789"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 43,
"end_pos": 43,
"sequence_org": "D",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DGT->NGT).",
"chr_id": "16",
"chr_pos": "70398404",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "D43",
"keywords": [
"ebi",
"germline"
]
}
],
"mutagenesis": [
{
"start_pos": 211,
"end_pos": 211,
"sequence_org": "N",
"sequence_mut": "Q",
"comment": "Impairs N-glycosylation. Impairs exit from the endoplasmic reticulum. Decreases sialyltransferase activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
},
{
"database": "PubMed",
"id": "25916169",
"url": "https://glygen.org/publication/PubMed/25916169"
}
]
},
{
"start_pos": 92,
"end_pos": 92,
"sequence_org": "N",
"sequence_mut": "Q",
"comment": "Has a moderate effect on N-glycosylation and sialyltransferase activity; when associated with Q-211.",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
},
{
"database": "PubMed",
"id": "25916169",
"url": "https://glygen.org/publication/PubMed/25916169"
}
]
}
],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "77.98",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000157350",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000157350"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "76.68",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000157350",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000157350"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "77.71",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000157350",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000157350"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "83.3",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000157350",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000157350"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "81.23",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000157350",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000157350"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "76.62",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000157350",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000157350"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "80.63",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000157350",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000157350"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "79.43",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000157350",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000157350"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "77.97",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000157350",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000157350"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "79.51",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000157350",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000157350"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "80.25",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000157350",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000157350"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "78.19",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000157350",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000157350"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "77.91",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000157350",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000157350"
}
]
}
],
"expression_disease": [
{
"significant": "Yes",
"trend": "down",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "Q16842",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q16842"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "Q16842",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q16842"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "Q16842",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q16842"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "Q16842",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q16842"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "Q16842",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q16842"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "Q16842",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q16842"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "Q16842",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q16842"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "Q16842",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q16842"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "Q16842",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q16842"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "Q16842",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q16842"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "Q16842",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q16842"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "Q16842",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q16842"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "ST3GAL2",
"url": "https://www.uniprot.org/uniprot/Q16842",
"locus": {
"chromosome": "16",
"start_pos": 70375977,
"end_pos": 70439237,
"strand": "+",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000157350",
"url": "https://www.ensembl.org/id/ENSG00000157350"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000157350",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000157350",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "2.4.99.2",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.4.99.2&UniProtAcc=Q16842",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "GT29",
"url": "http://www.cazy.org/GT29.html",
"database": "CAZy",
"categories": [
"Protein Classification"
]
},
{
"id": "ST3GAL2",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ST3GAL2",
"database": "GeneCards",
"categories": [
"Organism-specific",
"Gene Annotation"
]
},
{
"id": "6483",
"url": "https://www.ncbi.nlm.nih.gov/gene/6483",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "1119",
"url": "https://glyconnect.expasy.org/browser/proteins/1119",
"database": "GlyConnect",
"categories": [
"Glycan",
"Glycoproteomics"
]
},
{
"id": "10863",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=10863",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "Q16842",
"url": "https://www.ebi.ac.uk/intact/interactors/id:Q16842*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR001675",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR001675",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR012163",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR012163",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR038578",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR038578",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:6483",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:6483",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "607188",
"url": "http://www.omim.org/entry/607188",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_Q16842",
"url": "https://www.nextprot.org/entry/NX_Q16842",
"database": "neXtProt",
"categories": [
"Organism-specific",
"Protein"
]
},
{
"id": "ISPVWTK",
"url": "https://omabrowser.org/oma/group/ISPVWTK/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "5348004at2759",
"url": "http://www.orthodb.org/?query=5348004at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR46032",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46032",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR46032:SF4",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46032:SF4",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PF00777",
"url": "http://pfam.xfam.org/family/PF00777",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "Q16842",
"url": "https://pharos.nih.gov/targets/Q16842",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_Q16842",
"url": "http://purl.obolibrary.org/obo/PR_Q16842",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-2022854",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9683673",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9683673",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9694548",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9694719",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694719",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-977068",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977068",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_008858",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_008858",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "18021",
"url": "https://www.rhea-db.org/rhea/18021",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "21616",
"url": "https://www.rhea-db.org/rhea/21616",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "47560",
"url": "https://www.rhea-db.org/rhea/47560",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "47572",
"url": "https://www.rhea-db.org/rhea/47572",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "48240",
"url": "https://www.rhea-db.org/rhea/48240",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "48244",
"url": "https://www.rhea-db.org/rhea/48244",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "48248",
"url": "https://www.rhea-db.org/rhea/48248",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "48260",
"url": "https://www.rhea-db.org/rhea/48260",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "65372",
"url": "https://www.rhea-db.org/rhea/65372",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "Q16842-1",
"url": "https://www.uniprot.org/uniprot/Q16842-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKVLDLLWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFGADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN",
"length": 350,
"header": "sp|Q16842-1|SIA4B_HUMAN Isoform 1 of CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST3GAL2 PE=1 SV=1 CANONICAL=Q16842-1"
},
"isoforms": [
{
"isoform_ac": "Q16842-1",
"url": "",
"sequence": {
"sequence": "MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKVLDLLWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFGADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN",
"length": 350,
"header": "sp|Q16842-1|SIA4B_HUMAN Isoform 1 of CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST3GAL2 PE=1 SV=1 CANONICAL=Q16842-1"
},
"locus": {
"chromosome": "16",
"start_pos": 70398530,
"end_pos": 70381692,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000342907.3",
"url": "https://www.ensembl.org/id/ENST00000342907.3"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000345477.2",
"url": "https://www.ensembl.org/id/ENSP00000345477.2"
}
]
}
}
],
"glycosylation": [
{
"glytoucan_ac": "",
"type": "N-linked",
"subtype": "",
"site_category": "reported",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 123,
"start_aa": "Asn",
"end_pos": 123,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn123",
"evidence": [
{
"id": "24190977",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/24190977"
},
{
"id": "GLY_000143",
"database": "GlyGen",
"url": "https://data.glygen.org/GLY_000143"
}
]
},
{
"glytoucan_ac": "G06110VR",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 211,
"start_aa": "Asn",
"end_pos": 211,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn211",
"evidence": [
{
"id": "1119",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/1119"
},
{
"id": "29741879",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29741879"
}
]
},
{
"glytoucan_ac": "G23453IV",
"type": "N-linked",
"subtype": "",
"site_category": "reported_with_glycan",
"site_seq": "N",
"relation": "attached",
"comment": "",
"start_pos": 211,
"start_aa": "Asn",
"end_pos": 211,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn211",
"evidence": [
{
"id": "1119",
"database": "GlyConnect",
"url": "https://glyconnect.expasy.org/browser/proteins/1119"
},
{
"id": "29741879",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29741879"
}
]
},
{
"glytoucan_ac": "",
"type": "N-linked",
"subtype": "",
"site_category": "reported",
"site_seq": "N",
"relation": "attached",
"comment": "N-linked (GlcNAc...) asparagine",
"start_pos": 211,
"start_aa": "Asn",
"end_pos": 211,
"end_aa": "Asn",
"residue": "Asn",
"site_lbl": "Asn211",
"evidence": [
{
"id": "Q16842",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16842#ptm_processing"
},
{
"id": "25916169",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/25916169"
}
]
}
],
"phosphorylation": [],
"glycation": [],
"keywords": [
"enzyme",
"glycosyltransferase-activity",
"glycoprotein",
"glycoprotein_reported",
"glycoprotein_reported_with_glycan"
],
"publication": [
{
"title": "Cloning and characterization of NEU2, a human gene homologous to rodent soluble sialidases.",
"journal": "Genomics",
"date": "1999",
"authors": "Monti E, Preti A, Rossi E, Ballabio A, Borsani G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "10191093",
"url": "https://glygen.org/publication/PubMed/10191093"
}
]
},
{
"title": "Molecular cloning of a novel alpha2,3-sialyltransferase (ST3Gal VI) that sialylates type II lactosamine structures on glycoproteins and glycolipids.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Okajima T, Fukumoto S, Miyazaki H, Ishida H, Kiso M, Furukawa K, Urano T, Furukawa K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "10206952",
"url": "https://glygen.org/publication/PubMed/10206952"
}
]
},
{
"title": "Mutations in the human UDP-N-acetylglucosamine 2-epimerase gene define the disease sialuria and the allosteric site of the enzyme.",
"journal": "American journal of human genetics",
"date": "1999",
"authors": "Seppala R, Lehto VP, Gahl WA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "10330343",
"url": "https://glygen.org/publication/PubMed/10330343"
}
]
},
{
"title": "UDP-GlcNAc 2-epimerase: a regulator of cell surface sialylation.",
"journal": "Science (New York, N.Y.)",
"date": "1999",
"authors": "Keppler OT, Hinderlich S, Langner J, Schwartz-Albiez R, Reutter W, Pawlita M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "10334995",
"url": "https://glygen.org/publication/PubMed/10334995"
}
]
},
{
"title": "Cloning, expression, and chromosomal mapping of a human ganglioside sialidase.",
"journal": "Biochemical and biophysical research communications",
"date": "1999",
"authors": "Wada T, Yoshikawa Y, Tokuyama S, Kuwabara M, Akita H, Miyagi T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "10405317",
"url": "https://glygen.org/publication/PubMed/10405317"
}
]
},
{
"title": "Primary structure and expression analysis of human UDP-N-acetyl-glucosamine-2-epimerase/N-acetylmannosamine kinase, the bifunctional enzyme in neuraminic acid biosynthesis.",
"journal": "FEBS letters",
"date": "1999",
"authors": "Lucka L, Krause M, Danker K, Reutter W, Horstkorte R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "10431835",
"url": "https://glygen.org/publication/PubMed/10431835"
}
]
},
{
"title": "Cloning and characterization of a mammalian N-acetylglucosamine-6-sulfotransferase that is highly restricted to intestinal tissue.",
"journal": "Biochemical and biophysical research communications",
"date": "1999",
"authors": "Lee JK, Bhakta S, Rosen SD, Hemmerich S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2022854",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854"
}
],
"reference": [
{
"type": "PubMed",
"id": "10491328",
"url": "https://glygen.org/publication/PubMed/10491328"
}
]
},
{
"title": "Molecular cloning and expression of Galbeta1,3GalNAc alpha2, 3-sialyltransferase from human fetal liver.",
"journal": "European journal of biochemistry",
"date": "1999",
"authors": "Shang J, Qiu R, Wang J, Liu J, Zhou R, Ding H, Yang S, Zhang S, Jin C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "10504389",
"url": "https://glygen.org/publication/PubMed/10504389"
}
]
},
{
"title": "Cloning and expression of a human gene encoding an N-acetylgalactosamine-alpha2,6-sialyltransferase (ST6GalNAc I): a candidate for synthesis of cancer-associated sialyl-Tn antigens.",
"journal": "Glycobiology",
"date": "1999",
"authors": "Ikehara Y, Kojima N, Kurosawa N, Kudo T, Kono M, Nishihara S, Issiki S, Morozumi K, Itzkowitz S, Tsuda T, Nishimura SI, Tsuji S, Narimatsu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "10536037",
"url": "https://glygen.org/publication/PubMed/10536037"
}
]
},
{
"title": "A new gene, encoding an anion transporter, is mutated in sialic acid storage diseases.",
"journal": "Nature genetics",
"date": "1999",
"authors": "Verheijen FW, Verbeek E, Aula N, Beerens CE, Havelaar AC, Joosse M, Peltonen L, Aula P, Galjaard H, van der Spek PJ, Mancini GM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "10581036",
"url": "https://glygen.org/publication/PubMed/10581036"
}
]
},
{
"title": "Molecular cloning and functional expression of human ST6GalNAc II. Molecular expression in various human cultured cells.",
"journal": "Biochimica et biophysica acta",
"date": "2000",
"authors": "Samyn-Petit B, Krzewinski-Recchi MA, Steelant WF, Delannoy P, Harduin-Lepers A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "10742600",
"url": "https://glygen.org/publication/PubMed/10742600"
}
]
},
{
"title": "Cloning and expression of the human N-acetylneuraminic acid phosphate synthase gene with 2-keto-3-deoxy-D-glycero- D-galacto-nononic acid biosynthetic ability.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Lawrence SM, Huddleston KA, Pitts LR, Nguyen N, Lee YC, Vann WF, Coleman TA, Betenbaugh MJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "10749855",
"url": "https://glygen.org/publication/PubMed/10749855"
}
]
},
{
"title": "Identification and expression of NEU3, a novel human sialidase associated to the plasma membrane.",
"journal": "The Biochemical journal",
"date": "2000",
"authors": "Monti E, Bassi MT, Papini N, Riboni M, Manzoni M, Venerando B, Croci G, Preti A, Ballabio A, Tettamanti G, Borsani G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "10861246",
"url": "https://glygen.org/publication/PubMed/10861246"
}
]
},
{
"title": "The spectrum of SLC17A5-gene mutations resulting in free sialic acid-storage diseases indicates some genotype-phenotype correlation.",
"journal": "American journal of human genetics",
"date": "2000",
"authors": "Aula N, Salomaki P, Timonen R, Verheijen F, Mancini G, Mansson JE, Aula P, Peltonen L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "10947946",
"url": "https://glygen.org/publication/PubMed/10947946"
}
]
},
{
"title": "Keratan sulfate: structure, biosynthesis, and function.",
"journal": "Glycobiology",
"date": "2000",
"authors": "Funderburgh JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2022854",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854"
}
],
"reference": [
{
"type": "PubMed",
"id": "11030741",
"url": "https://glygen.org/publication/PubMed/11030741"
}
]
},
{
"title": "Identification and characterization of three novel beta 1,3-N-acetylglucosaminyltransferases structurally related to the beta 1,3-galactosyltransferase family.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Shiraishi N, Natsume A, Togayachi A, Endo T, Akashima T, Yamada Y, Imai N, Nakagawa S, Koizumi S, Sekine S, Narimatsu H, Sasaki K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2022854",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854"
}
],
"reference": [
{
"type": "PubMed",
"id": "11042166",
"url": "https://glygen.org/publication/PubMed/11042166"
}
]
},
{
"title": "Functional expression and genomic structure of human N-acetylglucosamine-6-O-sulfotransferase that transfers sulfate to beta-N-acetylglucosamine at the nonreducing end of an N-acetyllactosamine sequence.",
"journal": "Biochimica et biophysica acta",
"date": "2000",
"authors": "Sakaguchi H, Kitagawa H, Sugahara K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2022854",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854"
}
],
"reference": [
{
"type": "PubMed",
"id": "11042394",
"url": "https://glygen.org/publication/PubMed/11042394"
}
]
},
{
"title": "Cloning, expression and gene organization of a human Neu5Ac alpha 2-3Gal beta 1-3GalNAc alpha 2,6-sialyltransferase: hST6GalNAcIV.",
"journal": "The Biochemical journal",
"date": "2000",
"authors": "Harduin-Lepers A, Stokes DC, Steelant WF, Samyn-Petit B, Krzewinski-Recchi MA, Vallejo-Ruiz V, Zanetta JP, Auge C, Delannoy P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "11062056",
"url": "https://glygen.org/publication/PubMed/11062056"
}
]
},
{
"title": "Unique disulfide bond structures found in ST8Sia IV polysialyltransferase are required for its activity.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Angata K, Yen TY, El-Battari A, Macher BA, Fukuda M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "11279095",
"url": "https://glygen.org/publication/PubMed/11279095"
}
]
},
{
"title": "Molecular cloning and characterization of UDP-GlcNAc:lactosylceramide beta 1,3-N-acetylglucosaminyltransferase (beta 3Gn-T5), an essential enzyme for the expression of HNK-1 and Lewis X epitopes on glycolipids.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Togayachi A, Akashima T, Ookubo R, Kudo T, Nishihara S, Iwasaki H, Natsume A, Mio H, Inokuchi J, Irimura T, Sasaki K, Narimatsu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2022854",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854"
}
],
"reference": [
{
"type": "PubMed",
"id": "11283017",
"url": "https://glygen.org/publication/PubMed/11283017"
}
]
},
{
"title": "The UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase gene is mutated in recessive hereditary inclusion body myopathy.",
"journal": "Nature genetics",
"date": "2001",
"authors": "Eisenberg I, Avidan N, Potikha T, Hochner H, Chen M, Olender T, Barash M, Shemesh M, Sadeh M, Grabov-Nardini G, Shmilevich I, Friedmann A, Karpati G, Bradley WG, Baumbach L, Lancet D, Asher EB, Beckmann JS, Argov Z, Mitrani-Rosenbaum S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "11528398",
"url": "https://glygen.org/publication/PubMed/11528398"
}
]
},
{
"title": "Galactosylation of N-linked oligosaccharides by human beta-1,4-galactosyltransferases I, II, III, IV, V, and VI expressed in Sf-9 cells.",
"journal": "Glycobiology",
"date": "2001",
"authors": "Guo S, Sato T, Shirane K, Furukawa K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2022854",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854"
}
],
"reference": [
{
"type": "PubMed",
"id": "11588157",
"url": "https://glygen.org/publication/PubMed/11588157"
}
]
},
{
"title": "Cloning and expression of human sialic acid pathway genes to generate CMP-sialic acids in insect cells.",
"journal": "Glycoconjugate journal",
"date": "2001",
"authors": "Lawrence SM, Huddleston KA, Tomiya N, Nguyen N, Lee YC, Vann WF, Coleman TA, Betenbaugh MJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "11602804",
"url": "https://glygen.org/publication/PubMed/11602804"
}
]
},
{
"title": "Identification of a novel membrane protein, HP59, with therapeutic potential as a target of tumor angiogenesis.",
"journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
"date": "2001",
"authors": "Fu C, Bardhan S, Cetateanu ND, Wamil BD, Wang Y, Yan HP, Shi E, Carter C, Venkov C, Yakes FM, Page DL, Lloyd RS, Mernaugh RL, Hellerqvist CG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "11751519",
"url": "https://glygen.org/publication/PubMed/11751519"
}
]
},
{
"title": "Molecular cloning and characterization of a novel UDP-GlcNAc:GalNAc-peptide beta1,3-N-acetylglucosaminyltransferase (beta 3Gn-T6), an enzyme synthesizing the core 3 structure of O-glycans.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Iwai T, Inaba N, Naundorf A, Zhang Y, Gotoh M, Iwasaki H, Kudo T, Togayachi A, Ishizuka Y, Nakanishi H, Narimatsu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2022854",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854"
}
],
"reference": [
{
"type": "PubMed",
"id": "11821425",
"url": "https://glygen.org/publication/PubMed/11821425"
}
]
},
{
"title": "Deficiency of UDP-galactose:N-acetylglucosamine beta-1,4-galactosyltransferase I causes the congenital disorder of glycosylation type IId.",
"journal": "The Journal of clinical investigation",
"date": "2002",
"authors": "Hansske B, Thiel C, Lubke T, Hasilik M, Honing S, Peters V, Heidemann PH, Hoffmann GF, Berger EG, von Figura K, Korner C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2022854",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854"
}
],
"reference": [
{
"type": "PubMed",
"id": "11901181",
"url": "https://glygen.org/publication/PubMed/11901181"
}
]
},
{
"title": "Nonaka myopathy is caused by mutations in the UDP-N-acetylglucosamine-2-epimerase/N-acetylmannosamine kinase gene (GNE).",
"journal": "Journal of human genetics",
"date": "2002",
"authors": "Kayashima T, Matsuo H, Satoh A, Ohta T, Yoshiura K, Matsumoto N, Nakane Y, Niikawa N, Kishino T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "11916006",
"url": "https://glygen.org/publication/PubMed/11916006"
}
]
},
{
"title": "Distal myopathy with rimmed vacuoles: novel mutations in the GNE gene.",
"journal": "Neurology",
"date": "2002",
"authors": "Tomimitsu H, Ishikawa K, Shimizu J, Ohkoshi N, Kanazawa I, Mizusawa H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "12177386",
"url": "https://glygen.org/publication/PubMed/12177386"
}
]
},
{
"title": "Enzymatic synthesis in vitro of the disulfated disaccharide unit of corneal keratan sulfate.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Akama TO, Misra AK, Hindsgaul O, Fukuda MN",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2022854",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854"
}
],
"reference": [
{
"type": "PubMed",
"id": "12218059",
"url": "https://glygen.org/publication/PubMed/12218059"
}
]
},
{
"title": "Characterization of the second type of human beta-galactoside alpha 2,6-sialyltransferase (ST6Gal II), which sialylates Galbeta 1,4GlcNAc structures on oligosaccharides preferentially. Genomic analysis of human sialyltransferase genes.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Takashima S, Tsuji S, Tsujimoto M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "12235148",
"url": "https://glygen.org/publication/PubMed/12235148"
}
]
},
{
"title": "An Italian family with autosomal recessive inclusion-body myopathy and mutations in the GNE gene.",
"journal": "Neurology",
"date": "2002",
"authors": "Broccolini A, Pescatori M, D'Amico A, Sabino A, Silvestri G, Ricci E, Servidei S, Tonali PA, Mirabella M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "12473780",
"url": "https://glygen.org/publication/PubMed/12473780"
}
]
},
{
"title": "Genomic structure, expression, and transcriptional regulation of human Gal beta 1,3 GalNAc alpha 2,3-sialyltransferase gene.",
"journal": "Biochemical and biophysical research communications",
"date": "2003",
"authors": "Taniguchi A, Morishima T, Tsujita Y, Matsumoto Y, Matsumoto K",
"evidence": [
{
"database": "RefSeq",
"id": "NP_008858",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_008858"
}
],
"reference": [
{
"type": "PubMed",
"id": "12504121",
"url": "https://glygen.org/publication/PubMed/12504121"
}
]
},
{
"title": "Identification and functional expression of a second human beta-galactoside alpha2,6-sialyltransferase, ST6Gal II.",
"journal": "European journal of biochemistry",
"date": "2003",
"authors": "Krzewinski-Recchi MA, Julien S, Juliant S, Teintenier-Lelievre M, Samyn-Petit B, Montiel MD, Mir AM, Cerutti M, Harduin-Lepers A, Delannoy P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "12603328",
"url": "https://glygen.org/publication/PubMed/12603328"
}
]
},
{
"title": "Synthesis of disialyl Lewis a (Le(a)) structure in colon cancer cell lines by a sialyltransferase, ST6GalNAc VI, responsible for the synthesis of alpha-series gangliosides.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Tsuchida A, Okajima T, Furukawa K, Ando T, Ishida H, Yoshida A, Nakamura Y, Kannagi R, Kiso M, Furukawa K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "12668675",
"url": "https://glygen.org/publication/PubMed/12668675"
}
]
},
{
"title": "Human alpha2,3-sialyltransferase (ST3Gal II) is a stage-specific embryonic antigen-4 synthase.",
"journal": "J. Biol. Chem.",
"date": "2003",
"authors": "Saito S, Aoki H, Ito A, Ueno S, Wada T, Mitsuzuka K, Satoh M, Arai Y, Miyagi T",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
},
{
"database": "RefSeq",
"id": "NP_008858",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_008858"
}
],
"reference": [
{
"type": "PubMed",
"id": "12716912",
"url": "https://glygen.org/publication/PubMed/12716912"
}
]
},
{
"title": "Hereditary inclusion body myopathy: the Middle Eastern genetic cluster.",
"journal": "Neurology",
"date": "2003",
"authors": "Argov Z, Eisenberg I, Grabov-Nardini G, Sadeh M, Wirguin I, Soffer D, Mitrani-Rosenbaum S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "12743242",
"url": "https://glygen.org/publication/PubMed/12743242"
}
]
},
{
"title": "Molecular cloning and characterization of NEU4, the fourth member of the human sialidase gene family.",
"journal": "Genomics",
"date": "2004",
"authors": "Monti E, Bassi MT, Bresciani R, Civini S, Croci GL, Papini N, Riboni M, Zanchetti G, Ballabio A, Preti A, Tettamanti G, Venerando B, Borsani G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "14962670",
"url": "https://glygen.org/publication/PubMed/14962670"
}
]
},
{
"title": "Distal myopathy with rimmed vacuoles (DMRV): new GNE mutations and splice variant.",
"journal": "Neurology",
"date": "2004",
"authors": "Tomimitsu H, Shimizu J, Ishikawa K, Ohkoshi N, Kanazawa I, Mizusawa H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "15136692",
"url": "https://glygen.org/publication/PubMed/15136692"
}
]
},
{
"title": "Neu4, a novel human lysosomal lumen sialidase, confers normal phenotype to sialidosis and galactosialidosis cells.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Seyrantepe V, Landry K, Trudel S, Hassan JA, Morales CR, Pshezhetsky AV",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "15213228",
"url": "https://glygen.org/publication/PubMed/15213228"
}
]
},
{
"title": "Role of the human ST6GalNAc-I and ST6GalNAc-II in the synthesis of the cancer-associated sialyl-Tn antigen.",
"journal": "Cancer research",
"date": "2004",
"authors": "Marcos NT, Pinho S, Grandela C, Cruz A, Samyn-Petit B, Harduin-Lepers A, Almeida R, Silva F, Morais V, Costa J, Kihlberg J, Clausen H, Reis CA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977068",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977068"
}
],
"reference": [
{
"type": "PubMed",
"id": "15466199",
"url": "https://glygen.org/publication/PubMed/15466199"
}
]
},
{
"title": "Cloning and tissue distribution of the human B3GALT7 gene, a member of the beta1,3-Glycosyltransferase family.",
"journal": "Glycoconjugate journal",
"date": "2004",
"authors": "Huang C, Zhou J, Wu S, Shan Y, Teng S, Yu L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2022854",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854"
}
],
"reference": [
{
"type": "PubMed",
"id": "15486459",
"url": "https://glygen.org/publication/PubMed/15486459"
}
]
},
{
"title": "Crystal structure of the human cytosolic sialidase Neu2. Evidence for the dynamic nature of substrate recognition.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Chavas LM, Tringali C, Fusi P, Venerando B, Tettamanti G, Kato R, Monti E, Wakatsuki S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "15501818",
"url": "https://glygen.org/publication/PubMed/15501818"
}
]
},
{
"title": "Characterization of a cDNA encoding a protein with limited similarity to beta1, 3-N-acetylglucosaminyltransferase.",
"journal": "Molecular biology reports",
"date": "2004",
"authors": "Zheng H, Li Y, Ji C, Li J, Zhang J, Yin G, Xu J, Ye X, Wu M, Zou X, Gu S, Xie Y, Mao Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2022854",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854"
}
],
"reference": [
{
"type": "PubMed",
"id": "15560372",
"url": "https://glygen.org/publication/PubMed/15560372"
}
]
},
{
"title": "Genetic complementation reveals a novel human congenital disorder of glycosylation of type II, due to inactivation of the Golgi CMP-sialic acid transporter.",
"journal": "Blood",
"date": "2005",
"authors": "Martinez-Duncker I, Dupre T, Piller V, Piller F, Candelier JJ, Trichet C, Tchernia G, Oriol R, Mollicone R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "15576474",
"url": "https://glygen.org/publication/PubMed/15576474"
}
]
},
{
"title": "A novel beta1,3-N-acetylglucosaminyltransferase (beta3Gn-T8), which synthesizes poly-N-acetyllactosamine, is dramatically upregulated in colon cancer.",
"journal": "FEBS letters",
"date": "2005",
"authors": "Ishida H, Togayachi A, Sakai T, Iwai T, Hiruma T, Sato T, Okubo R, Inaba N, Kudo T, Gotoh M, Shoda J, Tanaka N, Narimatsu H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2022854",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854"
}
],
"reference": [
{
"type": "PubMed",
"id": "15620693",
"url": "https://glygen.org/publication/PubMed/15620693"
}
]
},
{
"title": "A novel splice variant of human gene NPL, mainly expressed in human liver, kidney and peripheral blood leukocyte.",
"journal": "DNA sequence : the journal of DNA sequencing and mapping",
"date": "2005",
"authors": "Wu M, Gu S, Xu J, Zou X, Zheng H, Jin Z, Xie Y, Ji C, Mao Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "16147865",
"url": "https://glygen.org/publication/PubMed/16147865"
}
]
},
{
"title": "Identification of the sequence encoding N-acetylneuraminate-9-phosphate phosphatase.",
"journal": "Glycobiology",
"date": "2006",
"authors": "Maliekal P, Vertommen D, Delpierre G, Van Schaftingen E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "16237198",
"url": "https://glygen.org/publication/PubMed/16237198"
}
]
},
{
"title": "The ST6GalNAc-I sialyltransferase localizes throughout the Golgi and is responsible for the synthesis of the tumor-associated sialyl-Tn O-glycan in human breast cancer.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Sewell R, Backstrom M, Dalziel M, Gschmeissner S, Karlsson H, Noll T, Gatgens J, Clausen H, Hansson GC, Burchell J, Taylor-Papadimitriou J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977068",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977068"
}
],
"reference": [
{
"type": "PubMed",
"id": "16319059",
"url": "https://glygen.org/publication/PubMed/16319059"
}
]
},
{
"title": "Glycosylation of the severe acute respiratory syndrome coronavirus triple-spanning membrane proteins 3a and M.",
"journal": "Journal of virology",
"date": "2006",
"authors": "Oostra M, de Haan CA, de Groot RJ, Rottier PJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9683673",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9683673"
}
],
"reference": [
{
"type": "PubMed",
"id": "16474139",
"url": "https://glygen.org/publication/PubMed/16474139"
}
]
},
{
"title": "Transition of galactosyltransferase 1 from trans-Golgi cisterna to the trans-Golgi network is signal mediated.",
"journal": "Molecular biology of the cell",
"date": "2006",
"authors": "Schaub BE, Berger B, Berger EG, Rohrer J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2022854",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854"
}
],
"reference": [
{
"type": "PubMed",
"id": "17021253",
"url": "https://glygen.org/publication/PubMed/17021253"
}
]
},
{
"title": "Identification and expression of a sialyltransferase responsible for the synthesis of disialylgalactosylgloboside in normal and malignant kidney cells: downregulation of ST6GalNAc VI in renal cancers.",
"journal": "The Biochemical journal",
"date": "2007",
"authors": "Senda M, Ito A, Tsuchida A, Hagiwara T, Kaneda T, Nakamura Y, Kasama K, Kiso M, Yoshikawa K, Katagiri Y, Ono Y, Ogiso M, Urano T, Furukawa K, Oshima S, Furukawa K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "17123352",
"url": "https://glygen.org/publication/PubMed/17123352"
}
]
},
{
"title": "Evidence for a molecular distinction between Golgi and cell surface forms of beta 1,4-galactosyltransferase.",
"journal": "The Journal of biological chemistry",
"date": "1991",
"authors": "Lopez LC, Youakim A, Evans SC, Shur BD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2022854",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854"
}
],
"reference": [
{
"type": "PubMed",
"id": "1714903",
"url": "https://glygen.org/publication/PubMed/1714903"
}
]
},
{
"title": "A mutation in a mild form of galactosialidosis impairs dimerization of the protective protein and renders it unstable.",
"journal": "The EMBO journal",
"date": "1991",
"authors": "Zhou XY, Galjart NJ, Willemsen R, Gillemans N, Galjaard H, d'Azzo A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "1756715",
"url": "https://glygen.org/publication/PubMed/1756715"
}
]
},
{
"title": "Plasma membrane-associated sialidase as a crucial regulator of transmembrane signalling.",
"journal": "Journal of biochemistry",
"date": "2008",
"authors": "Miyagi T, Wada T, Yamaguchi K, Hata K, Shiozaki K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "18632803",
"url": "https://glygen.org/publication/PubMed/18632803"
}
]
},
{
"title": "Human sialidase NEU4 long and short are extrinsic proteins bound to outer mitochondrial membrane and the endoplasmic reticulum, respectively.",
"journal": "Glycobiology",
"date": "2010",
"authors": "Bigi A, Morosi L, Pozzi C, Forcella M, Tettamanti G, Venerando B, Monti E, Fusi P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "19797320",
"url": "https://glygen.org/publication/PubMed/19797320"
}
]
},
{
"title": "Universal phosphatase-coupled glycosyltransferase assay.",
"journal": "Glycobiology",
"date": "2011",
"authors": "Wu ZL, Ethen CM, Prather B, Machacek M, Jiang W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "21081508",
"url": "https://glygen.org/publication/PubMed/21081508"
}
]
},
{
"title": "Metabolism of vertebrate amino sugars with N-glycolyl groups: elucidating the intracellular fate of the non-human sialic acid N-glycolylneuraminic acid.",
"journal": "The Journal of biological chemistry",
"date": "2012",
"authors": "Bergfeld AK, Pearce OM, Diaz SL, Pham T, Varki A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "22692205",
"url": "https://glygen.org/publication/PubMed/22692205"
}
]
},
{
"title": "Monitoring of S protein maturation in the endoplasmic reticulum by calnexin is important for the infectivity of severe acute respiratory syndrome coronavirus.",
"journal": "Journal of virology",
"date": "2012",
"authors": "Fukushi M, Yoshinaka Y, Matsuoka Y, Hatakeyama S, Ishizaka Y, Kirikae T, Sasazuki T, Miyoshi-Akiyama T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9694548",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548"
}
],
"reference": [
{
"type": "PubMed",
"id": "22915798",
"url": "https://glygen.org/publication/PubMed/22915798"
}
]
},
{
"title": "The B cell antigen CD75 is a cell surface sialytransferase.",
"journal": "The Journal of experimental medicine",
"date": "1990",
"authors": "Stamenkovic I, Asheim HC, Deggerdal A, Blomhoff HK, Smeland EB, Funderud S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-977068",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977068"
}
],
"reference": [
{
"type": "PubMed",
"id": "2373995",
"url": "https://glygen.org/publication/PubMed/2373995"
}
]
},
{
"title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.",
"journal": "Molecular & cellular proteomics : MCP",
"date": "2014",
"authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M",
"evidence": [
{
"database": "GlyGen",
"id": "GLY_000143",
"url": "https://data.glygen.org/GLY_000143"
}
],
"reference": [
{
"type": "PubMed",
"id": "24190977",
"url": "https://glygen.org/publication/PubMed/24190977"
}
]
},
{
"title": "Critical role of evolutionarily conserved glycosylation at Asn211 in the intracellular trafficking and activity of sialyltransferase ST3Gal-II.",
"journal": "The Biochemical journal",
"date": "2015",
"authors": "Ruggiero FM, Vilcaes AA, Iglesias-Bartolome R, Daniotti JL",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842#ptm_processing"
},
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
},
{
"database": "RefSeq",
"id": "NP_008858",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_008858"
}
],
"reference": [
{
"type": "PubMed",
"id": "25916169",
"url": "https://glygen.org/publication/PubMed/25916169"
}
]
},
{
"title": "Ganglioside glycosyltransferases are S-acylated at conserved cysteine residues involved in homodimerisation.",
"journal": "The Biochemical journal",
"date": "2017",
"authors": "Chumpen Ramirez S, Ruggiero FM, Daniotti JL, Valdez Taubas J",
"evidence": [
{
"database": "RefSeq",
"id": "NP_008858",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_008858"
}
],
"reference": [
{
"type": "PubMed",
"id": "28698248",
"url": "https://glygen.org/publication/PubMed/28698248"
}
]
},
{
"title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.",
"journal": "Analytical chemistry",
"date": "2018",
"authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H",
"evidence": [
{
"database": "GlyConnect",
"id": "1119",
"url": "https://glyconnect.expasy.org/browser/proteins/1119"
}
],
"reference": [
{
"type": "PubMed",
"id": "29741879",
"url": "https://glygen.org/publication/PubMed/29741879"
}
]
},
{
"title": "Expression of cDNA encoding the human `protective protein` associated with lysosomal beta-galactosidase and neuraminidase: homology to yeast proteases.",
"journal": "Cell",
"date": "1988",
"authors": "Galjart NJ, Gillemans N, Harris A, van der Horst GT, Verheijen FW, Galjaard H, d'Azzo A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "3136930",
"url": "https://glygen.org/publication/PubMed/3136930"
}
]
},
{
"title": "Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2.",
"journal": "Glycobiology",
"date": "2020",
"authors": "Shajahan A, Supekar NT, Gleinich AS, Azadi P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9694548",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548"
}
],
"reference": [
{
"type": "PubMed",
"id": "32363391",
"url": "https://glygen.org/publication/PubMed/32363391"
}
]
},
{
"title": "Site-specific glycan analysis of the SARS-CoV-2 spike.",
"journal": "Science (New York, N.Y.)",
"date": "2020",
"authors": "Watanabe Y, Allen JD, Wrapp D, McLellan JS, Crispin M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9694548",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548"
}
],
"reference": [
{
"type": "PubMed",
"id": "32366695",
"url": "https://glygen.org/publication/PubMed/32366695"
}
]
},
{
"title": "Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: implications for vaccination and antibody therapeutics.",
"journal": "Glycobiology",
"date": "2020",
"authors": "Zhou D, Tian X, Qi R, Peng C, Zhang W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9694548",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548"
}
],
"reference": [
{
"type": "PubMed",
"id": "32518941",
"url": "https://glygen.org/publication/PubMed/32518941"
}
]
},
{
"title": "N and O glycosylation of the SARS-CoV-2 spike protein.",
"journal": "bioRxiv : the preprint server for biology",
"date": "2020",
"authors": "Sanda M, Morrison L, Goldman R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9694548",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548"
}
],
"reference": [
{
"type": "PubMed",
"id": "32676595",
"url": "https://glygen.org/publication/PubMed/32676595"
}
]
},
{
"title": "Spike glycoprotein and host cell determinants of SARS-CoV-2 entry and cytopathic effects.",
"journal": "Journal of virology",
"date": "2020",
"authors": "Nguyen HT, Zhang S, Wang Q, Anang S, Wang J, Ding H, Kappes JC, Sodroski J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9694548",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548"
}
],
"reference": [
{
"type": "PubMed",
"id": "33310888",
"url": "https://glygen.org/publication/PubMed/33310888"
}
]
},
{
"title": "Palmitoylation of SARS-CoV-2 S protein is essential for viral infectivity.",
"journal": "Signal transduction and targeted therapy",
"date": "2021",
"authors": "Wu Z, Zhang Z, Wang X, Zhang J, Ren C, Li Y, Gao L, Liang X, Wang P, Ma C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9694548",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548"
}
],
"reference": [
{
"type": "PubMed",
"id": "34117209",
"url": "https://glygen.org/publication/PubMed/34117209"
}
]
},
{
"title": "S-acylation of SARS-CoV-2 spike protein: Mechanistic dissection, in vitro reconstitution and role in viral infectivity.",
"journal": "The Journal of biological chemistry",
"date": "2021",
"authors": "Puthenveetil R, Lun CM, Murphy RE, Healy LB, Vilmen G, Christenson ET, Freed EO, Banerjee A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9694548",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548"
}
],
"reference": [
{
"type": "PubMed",
"id": "34428449",
"url": "https://glygen.org/publication/PubMed/34428449"
}
]
},
{
"title": "Palmitoylation of SARS-CoV-2 S protein is critical for S-mediated syncytia formation and virus entry.",
"journal": "Journal of medical virology",
"date": "2022",
"authors": "Li D, Liu Y, Lu Y, Gao S, Zhang L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9694548",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548"
}
],
"reference": [
{
"type": "PubMed",
"id": "34528721",
"url": "https://glygen.org/publication/PubMed/34528721"
}
]
},
{
"title": "S-acylation controls SARS-CoV-2 membrane lipid organization and enhances infectivity.",
"journal": "Developmental cell",
"date": "2021",
"authors": "Mesquita FS, Abrami L, Sergeeva O, Turelli P, Qing E, Kunz B, Raclot C, Paz Montoya J, Abriata LA, Gallagher T, Dal Peraro M, Trono D, D'Angelo G, van der Goot FG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9694548",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548"
}
],
"reference": [
{
"type": "PubMed",
"id": "34599882",
"url": "https://glygen.org/publication/PubMed/34599882"
}
]
},
{
"title": "The interactions of ZDHHC5/GOLGA7 with SARS-CoV-2 spike (S) protein and their effects on S protein's subcellular localization, palmitoylation and pseudovirus entry.",
"journal": "Virology journal",
"date": "2021",
"authors": "Zeng XT, Yu XX, Cheng W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9694548",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548"
}
],
"reference": [
{
"type": "PubMed",
"id": "34961524",
"url": "https://glygen.org/publication/PubMed/34961524"
}
]
},
{
"title": "Overlapping and unique substrate specificities of ST3GAL1 and 2 during hematopoietic and megakaryocytic differentiation.",
"journal": "Blood advances",
"date": "2022",
"authors": "Zhang N, Lin S, Cui W, Newman PJ",
"evidence": [
{
"database": "RefSeq",
"id": "NP_008858",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_008858"
}
],
"reference": [
{
"type": "PubMed",
"id": "35507766",
"url": "https://glygen.org/publication/PubMed/35507766"
}
]
},
{
"title": "Familial distal myopathy with rimmed vacuole and lamellar (myeloid) body formation.",
"journal": "Journal of the neurological sciences",
"date": "1981",
"authors": "Nonaka I, Sunohara N, Ishiura S, Satoyoshi E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "7252518",
"url": "https://glygen.org/publication/PubMed/7252518"
}
]
},
{
"title": "A human STX cDNA confers polysialic acid expression in mammalian cells.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Scheidegger EP, Sternberg LR, Roth J, Lowe JB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "7559389",
"url": "https://glygen.org/publication/PubMed/7559389"
}
]
},
{
"title": "Inhibition of alpha-glucosidase I of the glycoprotein-processing enzymes by 6-O-butanoyl castanospermine (MDL 28,574) and its consequences in human immunodeficiency virus-infected T cells.",
"journal": "Antimicrobial agents and chemotherapy",
"date": "1994",
"authors": "Taylor DL, Kang MS, Brennan TM, Bridges CG, Sunkara PS, Tyms AS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9694548",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548"
}
],
"reference": [
{
"type": "PubMed",
"id": "7986008",
"url": "https://glygen.org/publication/PubMed/7986008"
}
]
},
{
"title": "Cloning and expression of human Gal beta 1,3(4)GlcNAc alpha 2,3-sialyltransferase.",
"journal": "Biochemical and biophysical research communications",
"date": "1993",
"authors": "Kitagawa H, Paulson JC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "8333853",
"url": "https://glygen.org/publication/PubMed/8333853"
}
]
},
{
"title": "Three-dimensional structure of the human 'protective protein': structure of the precursor form suggests a complex activation mechanism.",
"journal": "Structure (London, England : 1993)",
"date": "1995",
"authors": "Rudenko G, Bonten E, d'Azzo A, Hol WG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "8591035",
"url": "https://glygen.org/publication/PubMed/8591035"
}
]
},
{
"title": "Characterization of two glycolipid: alpha 2-3sialyltransferases, SAT-3 (CMP-NeuAc:nLcOse4Cer alpha 2-3sialyltransferase) and SAT-4 (CMP-NeuAc:GgOse4Cer alpha 2-3sialyltransferase), from human colon carcinoma (Colo 205) cell line.",
"journal": "Biochemistry",
"date": "1996",
"authors": "Basu SS, Basu M, Li Z, Basu S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "8611500",
"url": "https://glygen.org/publication/PubMed/8611500"
}
]
},
{
"title": "Expression cloning of a human GT3 synthase. GD3 AND GT3 are synthesized by a single enzyme.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Nakayama J, Fukuda MN, Hirabayashi Y, Kanamori A, Sasaki K, Nishi T, Fukuda M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "8631981",
"url": "https://glygen.org/publication/PubMed/8631981"
}
]
},
{
"title": "Molecular cloning and expression of human Gal beta 1,3GalNAc alpha 2,3-sialyltransferase (hST3Gal II).",
"journal": "Biochem. Biophys. Res. Commun.",
"date": "1996",
"authors": "Kim YJ, Kim KS, Kim SH, Kim CH, Ko JH, Choe IS, Tsuji S, Lee YC",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
},
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "8920913",
"url": "https://glygen.org/publication/PubMed/8920913"
}
]
},
{
"title": "Characterization of human lysosomal neuraminidase defines the molecular basis of the metabolic storage disorder sialidosis.",
"journal": "Genes & development",
"date": "1996",
"authors": "Bonten E, van der Spoel A, Fornerod M, Grosveld G, d'Azzo A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "8985184",
"url": "https://glygen.org/publication/PubMed/8985184"
}
]
},
{
"title": "Molecular cloning and characterization of a novel isoform of the human UDP-galactose transporter, and of related complementary DNAs belonging to the nucleotide-sugar transporter gene family.",
"journal": "Journal of biochemistry",
"date": "1996",
"authors": "Ishida N, Miura N, Yoshioka S, Kawakita M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "9010752",
"url": "https://glygen.org/publication/PubMed/9010752"
}
]
},
{
"title": "Molecular cloning and expression of human alpha2,8-sialyltransferase (hST8Sia V).",
"journal": "Biochemical and biophysical research communications",
"date": "1997",
"authors": "Kim YJ, Kim KS, Do S, Kim CH, Kim SK, Lee YC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "9199191",
"url": "https://glygen.org/publication/PubMed/9199191"
}
]
},
{
"title": "Cloning and expression of cDNA for a human Gal(beta1-3)GalNAc alpha2,3-sialyltransferase from the CEM T-cell line.",
"journal": "Eur. J. Biochem.",
"date": "1997",
"authors": "Giordanengo V, Bannwarth S, Laffont C, Van Miegem V, Harduin-Lepers A, Delannoy P, Lefebvre JC",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"reference": [
{
"type": "PubMed",
"id": "9266697",
"url": "https://glygen.org/publication/PubMed/9266697"
}
]
},
{
"title": "Molecular cloning and characterization of human keratan sulfate Gal-6-sulfotransferase.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Fukuta M, Inazawa J, Torii T, Tsuzuki K, Shimada E, Habuchi O",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2022854",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854"
}
],
"reference": [
{
"type": "PubMed",
"id": "9405439",
"url": "https://glygen.org/publication/PubMed/9405439"
}
]
},
{
"title": "Cloning of a human UDP-galactose:2-acetamido-2-deoxy-D-glucose 3beta-galactosyltransferase catalyzing the formation of type 1 chains.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Kolbinger F, Streiff MB, Katopodis AG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2022854",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854"
}
],
"reference": [
{
"type": "PubMed",
"id": "9417100",
"url": "https://glygen.org/publication/PubMed/9417100"
}
]
},
{
"title": "The expanding beta 4-galactosyltransferase gene family: messages from the databanks.",
"journal": "Glycobiology",
"date": "1998",
"authors": "Lo NW, Shaper JH, Pevsner J, Shaper NL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2022854",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854"
}
],
"reference": [
{
"type": "PubMed",
"id": "9597550",
"url": "https://glygen.org/publication/PubMed/9597550"
}
]
},
{
"title": "Expression cloning and functional characterization of human cDNA for ganglioside GM3 synthase.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Ishii A, Ohta M, Watanabe Y, Matsuda K, Ishiyama K, Sakoe K, Nakamura M, Inokuchi J, Sanai Y, Saito M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "9822625",
"url": "https://glygen.org/publication/PubMed/9822625"
}
]
},
{
"title": "Cloning and expression of cDNA for a human Sia alpha 2,3Gal beta 1, 4GlcNA:alpha 2,8-sialyltransferase (hST8Sia III).",
"journal": "Archives of biochemistry and biophysics",
"date": "1998",
"authors": "Lee YC, Kim YJ, Lee KY, Kim KS, Kim BU, Kim HN, Kim CH, Do SI",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-4085001",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001"
}
],
"reference": [
{
"type": "PubMed",
"id": "9826427",
"url": "https://glygen.org/publication/PubMed/9826427"
}
]
}
],
"pathway": [
{
"id": "hsa:6483",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:6483",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-2022854",
"name": "Keratan sulfate biosynthesis",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854",
"resource": "Reactome",
"description": "Keratan sulfate biosynthesis"
},
{
"id": "R-HSA-4085001",
"name": "Sialic acid metabolism",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085001",
"resource": "Reactome",
"description": "Sialic acid metabolism"
},
{
"id": "R-HSA-9683673",
"name": "Maturation of protein 3a",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9683673",
"resource": "Reactome",
"description": "Maturation of protein 3a"
},
{
"id": "R-HSA-9694548",
"name": "Maturation of spike protein",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694548",
"resource": "Reactome",
"description": "Maturation of spike protein"
},
{
"id": "R-HSA-9694719",
"name": "Maturation of protein 3a",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694719",
"resource": "Reactome",
"description": "Maturation of protein 3a"
},
{
"id": "R-HSA-977068",
"name": "Termination of O-glycan biosynthesis",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977068",
"resource": "Reactome",
"description": "Termination of O-glycan biosynthesis"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "Q11204-1",
"protein_name": "CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2",
"gene_name": "St3gal2",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MKCSLRVWFLSMAFLLVFIMSLLFTYSHHSMATLPYLDSGALGGTHRVKLVPGYSGLQRLGKEGLLGRNCACSRCMGDASTSEWFDSHFDGNISPVWTRDNMNLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPQQCRRCAVVGNSGNLRGSGYGQEVDSHNFIMRMNQAPTVGFEKDVGSRTTHHFMYPESAKNLPANVSFVLVPFKALDLMWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFGADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN",
"length": 350
},
"evidence": [
{
"id": "45228008",
"url": "http://www.informatics.jax.org/homology/45228008",
"database": "MGI"
},
{
"id": "Q16842",
"url": "https://omabrowser.org/oma/group/Q16842/",
"database": "OMA"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "Q11205-1",
"protein_name": "CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2",
"gene_name": "St3gal2",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MKCSLRVWFLSMAFLLVFIMSLLFTYSHHSMATLPYLDSGTLGGTHRVKLVPGYTGQQRLVKEGLSGKSCTCSRCMGDAGTSEWFDSHFDSNISPVWTRDNMNLTPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPQQCRRCAVVGNSGNLRGSGYGQEVDSHNFIMRMNQAPTVGFEKDVGSRTTHHFMYPESAKNLPANVSFVLVPFKALDLMWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFGADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDILAKASKIEVYRGN",
"length": 350
},
"evidence": [
{
"id": "45228008",
"url": "http://www.informatics.jax.org/homology/45228008",
"database": "MGI"
}
],
"common_name": "Rat"
}
],
"go_annotation": {
"categories": [
{
"name": "Biological Process",
"total": 12,
"go_terms": [
{
"name": "viral protein processing",
"id": "GO:0019082",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019082",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
},
{
"name": "protein glycosylation",
"id": "GO:0006486",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006486",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
},
{
"name": "glycoprotein biosynthetic process",
"id": "GO:0009101",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009101",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
},
{
"name": "O-glycan processing",
"id": "GO:0016266",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016266",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
},
{
"name": "glycolipid biosynthetic process",
"id": "GO:0009247",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009247",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
},
{
"name": "lipid glycosylation",
"id": "GO:0030259",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030259",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
},
{
"name": "oligosaccharide biosynthetic process",
"id": "GO:0009312",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009312",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
},
{
"name": "keratan sulfate biosynthetic process",
"id": "GO:0018146",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018146",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
},
{
"name": "sialylation",
"id": "GO:0097503",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097503",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
},
{
"name": "protein sialylation",
"id": "GO:1990743",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990743",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
},
{
"name": "globoside biosynthetic process via lactosylceramide",
"id": "GO:0010707",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010707",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
},
{
"name": "ganglioside biosynthetic process via lactosylceramide",
"id": "GO:0010706",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010706",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 4,
"go_terms": [
{
"name": "Golgi membrane",
"id": "GO:0000139",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
},
{
"name": "extracellular region",
"id": "GO:0005576",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
},
{
"name": "membrane",
"id": "GO:0016020",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
},
{
"name": "Golgi cisterna membrane",
"id": "GO:0032580",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032580",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
}
]
},
{
"name": "Molecular Function",
"total": 4,
"go_terms": [
{
"name": "protein homodimerization activity",
"id": "GO:0042803",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
},
{
"name": "sialyltransferase activity",
"id": "GO:0008373",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008373",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
},
{
"name": "beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminide alpha-2,3- sialyltransferase",
"id": "GO:0047288",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047288",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
},
{
"name": "beta-galactoside (CMP) alpha-2,3-sialyltransferase activity",
"id": "GO:0003836",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003836",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [
{
"start_pos": 211,
"end_pos": 213,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 92,
"end_pos": 94,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [
{
"annotation": "N-glycosylated; necessary for proper exit from endoplasmic reticulum and trafficking to the Golgi apparatus.",
"evidence": [
{
"database": "UniProtKB",
"id": "Q16842",
"url": "https://www.uniprot.org/uniprot/Q16842"
},
{
"database": "PubMed",
"id": "25916169",
"url": "https://glygen.org/publication/PubMed/25916169"
}
]
}
],
"interactions": [],
"reactions": [
{
"id": "18021",
"name": "",
"equation": "CMP-N-acetyl-beta-neuraminate + ganglioside GM1 (d18:1(4E)) = CMP + ganglioside GD1a (d18:1(4E)) + H(+)",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q11205-1",
"P61131-1",
"Q16842-1",
"Q11201-1",
"Q11206-1",
"Q91Y74-1",
"P54751-1",
"Q11204-1"
],
"evidence": [
{
"id": "18021",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/18021"
}
]
},
{
"id": "21616",
"name": "",
"equation": "a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+)",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q11205-1",
"P61131-1",
"Q16842-1",
"Q11201-1",
"Q11206-1",
"Q91Y74-1",
"P54751-1",
"Q11204-1"
],
"evidence": [
{
"id": "21616",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/21616"
}
]
},
{
"id": "47560",
"name": "",
"equation": "CMP-N-acetyl-beta-neuraminate + ganglioside GA1 (d18:1(4E)) = CMP + ganglioside GM1b (d18:1(4E)) + H(+)",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q11205-1",
"P61131-1",
"Q11201-1",
"Q16842-1",
"Q11206-1",
"P54751-1",
"Q91Y74-1",
"Q11204-1"
],
"evidence": [
{
"id": "47560",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/47560"
}
]
},
{
"id": "47572",
"name": "",
"equation": "CMP-N-acetyl-beta-neuraminate + ganglioside GD1b (d18:1(4E)) = CMP + ganglioside GT1b (d18:1(4E)) + H(+)",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q16842-1",
"Q11204-1"
],
"evidence": [
{
"id": "47572",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/47572"
}
]
},
{
"id": "48240",
"name": "",
"equation": "CMP-N-acetyl-beta-neuraminate + ganglioside GD1b = CMP + ganglioside GT1b + H(+)",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q11201-1",
"Q16842-1",
"P54751-1",
"Q11204-1"
],
"evidence": [
{
"id": "48240",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/48240"
}
]
},
{
"id": "48244",
"name": "",
"equation": "CMP-N-acetyl-beta-neuraminate + ganglioside GA1 = CMP + ganglioside GM1b + H(+)",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q11205-1",
"Q11201-1",
"Q16842-1",
"P54751-1",
"Q11204-1"
],
"evidence": [
{
"id": "48244",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/48244"
}
]
},
{
"id": "48248",
"name": "",
"equation": "CMP-N-acetyl-beta-neuraminate + ganglioside GM1 (d18:1(4E)/18:0) = CMP + ganglioside GD1a (18:1(4E)/18:0) + H(+)",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q11205-1",
"Q11201-1",
"Q16842-1",
"P54751-1",
"Q11204-1"
],
"evidence": [
{
"id": "48248",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/48248"
}
]
},
{
"id": "48260",
"name": "",
"equation": "CMP-N-acetyl-beta-neuraminate + ganglioside GM1 = CMP + ganglioside GD1a + H(+)",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q11201-1",
"Q16842-1"
],
"evidence": [
{
"id": "48260",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/48260"
}
]
},
{
"id": "65372",
"name": "",
"equation": "CMP-N-acetyl-beta-neuraminate + globoside GalGb4Cer = CMP + globoside MSGG + H(+)",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q11205-1",
"Q16842-1",
"Q11204-1"
],
"evidence": [
{
"id": "65372",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/65372"
}
]
},
{
"id": "R-HSA-2046285",
"name": "The keratan chain can be capped by N-acetylneuraminic acid",
"equation": "",
"summary": "The human genes ST3GAL1-4 and 6 encode for sialyltransferase1-4 and 6 respectively (Shang et al. 1999, Kim et al. 1996, Kitagawa and Paulson, 1993, Basu et al. 1993, Okajima et al. 1999). They add a sialyl residue to the growing keratan chain, blocking any further chain elongation.",
"cellular_location": "Golgi lumen, Golgi membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q9Y274-1",
"Q11201-1",
"Q11206-1",
"Q16842-1",
"Q11203-1"
],
"evidence": [
{
"id": "R-HSA-2046285",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046285"
}
]
},
{
"id": "R-HSA-4084984",
"name": "ST3GAL1-6 transfer Neu5Ac to terminal Gal (alpha-2,3 link)",
"equation": "",
"summary": "The alpha-2,3-sialyltransferases 1-6 (ST3GAL1-6) are able to transfer a sialic acid (Neu5Ac) moiety to the terminal galactosyl (Gal-R) residue of O-glycosylated proteins and some gangliosides. Neu5Ac is added to Gal-R via an alpha-2,3 linkage (Shang et al. 1999, Kim et al. 1996, Kitagawa & Paulson 1993, Basu et al. 1993, Ishii et al. 1998, Okajima et al. 1999). Once sialylated, glycoconjugates translocate to the plasma membrane by an unknown mechanism. For simplicity, Gal is shown in a generic form where R represents other sugars O-linked to proteins which can result in a large variability in glycoconjugate structures.",
"cellular_location": "Golgi lumen, Golgi membrane",
"input_participant_list": [
"R-ALL-4086285"
],
"output_participant_list": [
"R-ALL-727810",
"R-ALL-4086277"
],
"enzyme_list": [
"Q9Y274-1",
"Q11201-1",
"Q11206-1",
"Q16842-1",
"Q11203-1",
"Q9UNP4-1"
],
"evidence": [
{
"id": "R-HSA-4084984",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4084984"
}
]
},
{
"id": "R-HSA-9683769",
"name": "O-glycosylation of 3a is terminated",
"equation": "",
"summary": "A sialyltransferase adds a terminal sialic acid moiety to protein 3a with an O-linked glycosyl side chain. This glycosylated form later is associated with the virion (Oostra et al, 2006).",
"cellular_location": "endoplasmic reticulum-Golgi intermediate compartment",
"input_participant_list": [
"R-ALL-9699093",
"R-COV-9683709"
],
"output_participant_list": [
"R-ALL-9699094",
"R-COV-9683640"
],
"enzyme_list": [
"Q11201-1",
"Q11206-1",
"Q16842-1",
"Q8NDV1-1",
"Q11203-1",
"P15907-1",
"Q9H4F1-1",
"Q9UJ37-1"
],
"evidence": [
{
"id": "R-HSA-9683769",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9683769"
}
]
},
{
"id": "R-HSA-9694718",
"name": "O-glycosylation of 3a is terminated",
"equation": "",
"summary": "This COVID-19 event has been created by a combination of computational inference (see https://reactome.org/documentation/inferred-events) from SARS-CoV-1 data and manual curation, as described in the summation for the overall SARS-CoV-2 infection pathway.
A sialyltransferase adds a terminal sialic acid moiety to protein 3a with an O-linked glycosyl side chain. This glycosylated form later is associated with the virion (Oostra et al, 2006)",
"cellular_location": "endoplasmic reticulum-Golgi intermediate compartment",
"input_participant_list": [
"R-COV-9694658"
],
"output_participant_list": [
"R-COV-9694386"
],
"enzyme_list": [
"Q11201-1",
"Q11206-1",
"Q16842-1",
"Q8NDV1-1",
"Q11203-1",
"P15907-1",
"Q9H4F1-1",
"Q9UJ37-1"
],
"evidence": [
{
"id": "R-HSA-9694718",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694718"
}
]
},
{
"id": "R-HSA-9697018",
"name": "Addition of sialic acids on some Spike glycosyl sidechains",
"equation": "",
"summary": "Glycosyl sidechains at Asn-1158 and Asn-1194 are sialylated, presumably by the cell's sialyltransferases (Watanabe et al, 2020).",
"cellular_location": "endoplasmic reticulum-Golgi intermediate compartment",
"input_participant_list": [
"R-COV-9697194"
],
"output_participant_list": [
"R-COV-9697197"
],
"enzyme_list": [
"Q11201-1",
"Q11206-1",
"Q16842-1",
"Q8NDV1-1",
"Q11203-1",
"P15907-1",
"Q9H4F1-1",
"Q9UJ37-1"
],
"evidence": [
{
"id": "R-HSA-9697018",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9697018"
}
]
},
{
"id": "R-HSA-981497",
"name": "ST3GAL1-4 transfers sialic acid to the T antigen at the alpha 3 position",
"equation": "",
"summary": "The human genes ST3GAL1-4 encode for sialyltransferases1-4 respectively (Shang et al. 1999, Kim et al. 1996, Kitagawa & Paulson 1993, Basu et al. 1993). They add silaic acid (Neu5Ac) onto the T antigen forming an alpha-3-sialyl O-glycan.",
"cellular_location": "Golgi lumen, Golgi membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q11201-1",
"Q11206-1",
"Q16842-1",
"Q11203-1"
],
"evidence": [
{
"id": "R-HSA-981497",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-981497"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-ALL-4086277",
"participant_name": "Neu5Ac-2,3-Gal-R [Golgi lumen]",
"crossref": [
{
"id": "75127",
"database": "ChEBI",
"url": ""
},
{
"id": "75127",
"database": "ChEBI",
"url": ""
},
{
"id": "75127",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-4086285",
"participant_name": "Gal-R [Golgi lumen]",
"crossref": [
{
"id": "61248",
"database": "ChEBI",
"url": ""
},
{
"id": "61248",
"database": "ChEBI",
"url": ""
},
{
"id": "61248",
"database": "ChEBI",
"url": ""
},
{
"id": "61248",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-727810",
"participant_name": "CMP [Golgi lumen]",
"crossref": [
{
"id": "C00055",
"database": "COMPOUND",
"url": ""
},
{
"id": "60377",
"database": "ChEBI",
"url": ""
},
{
"id": "000003861744",
"database": "ZINC",
"url": ""
},
{
"id": "60377",
"database": "ChEBI",
"url": ""
},
{
"id": "C00055",
"database": "COMPOUND",
"url": ""
},
{
"id": "000003861744",
"database": "ZINC",
"url": ""
},
{
"id": "C00055",
"database": "COMPOUND",
"url": ""
},
{
"id": "000003861744",
"database": "ZINC",
"url": ""
},
{
"id": "60377",
"database": "ChEBI",
"url": ""
},
{
"id": "C00055",
"database": "COMPOUND",
"url": ""
},
{
"id": "60377",
"database": "ChEBI",
"url": ""
},
{
"id": "000003861744",
"database": "ZINC",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9699093",
"participant_name": "CMP-Neu5Ac [endoplasmic reticulum-Golgi intermediate compartment]",
"crossref": [
{
"id": "000008215638",
"database": "ZINC",
"url": ""
},
{
"id": "57812",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-9699094",
"participant_name": "CMP [endoplasmic reticulum-Golgi intermediate compartment]",
"crossref": [
{
"id": "C00055",
"database": "COMPOUND",
"url": ""
},
{
"id": "17361",
"database": "ChEBI",
"url": ""
},
{
"id": "8144170",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000003861744",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0000095",
"database": "HMDB Metabolite",
"url": ""
}
]
},
{
"participant_id": "R-COV-9683640",
"participant_name": "O-glycosyl 3a [endoplasmic reticulum-Golgi intermediate compartment membrane]",
"crossref": [
{
"id": "P59632",
"database": "UniProt",
"url": ""
},
{
"id": "8EQS",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-COV-9683709",
"participant_name": "GalNAc-O-3a [endoplasmic reticulum-Golgi intermediate compartment]",
"crossref": [
{
"id": "P59632",
"database": "UniProt",
"url": ""
},
{
"id": "8EQS",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-COV-9694386",
"participant_name": "O-glycosyl 3a [endoplasmic reticulum-Golgi intermediate compartment membrane]",
"crossref": [
{
"id": "P0DTC3",
"database": "UniProt",
"url": ""
},
{
"id": "8EQU",
"database": "PDB",
"url": ""
},
{
"id": "6XDC",
"database": "PDB",
"url": ""
},
{
"id": "7KJR",
"database": "PDB",
"url": ""
},
{
"id": "8EQJ",
"database": "PDB",
"url": ""
},
{
"id": "8EQT",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-COV-9694658",
"participant_name": "GalNAc-O-3a [endoplasmic reticulum-Golgi intermediate compartment]",
"crossref": [
{
"id": "6XDC",
"database": "PDB",
"url": ""
},
{
"id": "P0DTC3",
"database": "UniProt",
"url": ""
},
{
"id": "8EQJ",
"database": "PDB",
"url": ""
},
{
"id": "8EQT",
"database": "PDB",
"url": ""
},
{
"id": "8EQU",
"database": "PDB",
"url": ""
},
{
"id": "7KJR",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-COV-9697194",
"participant_name": "tri-antennary N-glycan-PALM-Spike trimer [endoplasmic reticulum-Golgi intermediate compartment]",
"crossref": [
{
"id": "CPX-7042",
"database": "ComplexPortal",
"url": ""
},
{
"id": "CPX-5682",
"database": "ComplexPortal",
"url": ""
}
]
},
{
"participant_id": "R-COV-9697197",
"participant_name": "fully glycosylated Spike trimer [endoplasmic reticulum-Golgi intermediate compartment]",
"crossref": [
{
"id": "CPX-5682",
"database": "ComplexPortal",
"url": ""
},
{
"id": "CPX-7042",
"database": "ComplexPortal",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "P15907",
"gene_name": "ST6GAL1",
"activity": [
{
"ec_number": "2.4.3.1",
"activity": "a beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + CMP-N-acetyl-beta-neuraminate = CMP + H(+) + N-acetyl-alpha-neuraminyl-(2->6)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-ceramide.",
"evidence": [
{
"id": "P15907",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15907"
}
]
},
{
"ec_number": "2.4.3.1",
"activity": "",
"evidence": [
{
"id": "P15907",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P15907"
}
]
}
]
},
{
"uniprot_ac": "P54751",
"gene_name": "St3gal1",
"activity": [
{
"ec_number": "2.4.3.2",
"activity": "CMP-N-acetyl-beta-neuraminate + ganglioside GM1 (d18:1(4E)) = CMP + ganglioside GD1a (d18:1(4E)) + H(+).",
"evidence": [
{
"id": "P54751",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54751"
}
]
},
{
"ec_number": "2.4.3.4",
"activity": "a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+).",
"evidence": [
{
"id": "P54751",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54751"
}
]
},
{
"ec_number": "2.4.3.4",
"activity": "",
"evidence": [
{
"id": "P54751",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P54751"
}
]
}
]
},
{
"uniprot_ac": "P61131",
"gene_name": "St3gal4",
"activity": [
{
"ec_number": "3.6.1.59",
"activity": "a 5'-end (N(2),N(2),N(7)-trimethyl 5'-triphosphoguanosine)-(ribonucleoside) in mRNA + H2O = (N(2),N(2),N(7))-trimethyl-GMP + a 5'-end diphospho-ribonucleoside in mRNA + 2 H(+).",
"evidence": [
{
"id": "P61131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61131"
}
]
},
{
"ec_number": "3.6.1.59",
"activity": "",
"evidence": [
{
"id": "P61131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61131"
}
]
},
{
"ec_number": "2.4.3.2",
"activity": "CMP-N-acetyl-beta-neuraminate + ganglioside GM1 (d18:1(4E)) = CMP + ganglioside GD1a (d18:1(4E)) + H(+).",
"evidence": [
{
"id": "P61131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61131"
}
]
},
{
"ec_number": "2.4.3.4",
"activity": "a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+).",
"evidence": [
{
"id": "P61131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61131"
}
]
},
{
"ec_number": "2.4.3.6",
"activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP + H(+).",
"evidence": [
{
"id": "P61131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61131"
}
]
},
{
"ec_number": "2.4.3.2",
"activity": "",
"evidence": [
{
"id": "P61131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61131"
}
]
},
{
"ec_number": "2.4.3.4",
"activity": "",
"evidence": [
{
"id": "P61131",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P61131"
}
]
}
]
},
{
"uniprot_ac": "Q11201",
"gene_name": "ST3GAL1",
"activity": [
{
"ec_number": "2.4.3.2",
"activity": "CMP-N-acetyl-beta-neuraminate + ganglioside GM1 (d18:1(4E)) = CMP + ganglioside GD1a (d18:1(4E)) + H(+).",
"evidence": [
{
"id": "Q11201",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q11201"
}
]
},
{
"ec_number": "2.4.3.4",
"activity": "a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+).",
"evidence": [
{
"id": "Q11201",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q11201"
}
]
},
{
"ec_number": "2.4.3.4",
"activity": "",
"evidence": [
{
"id": "Q11201",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q11201"
}
]
}
]
},
{
"uniprot_ac": "Q11203",
"gene_name": "ST3GAL3",
"activity": [
{
"ec_number": "2.4.3.6",
"activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP + H(+).",
"evidence": [
{
"id": "Q11203",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q11203"
}
]
},
{
"ec_number": "2.4.3.6",
"activity": "",
"evidence": [
{
"id": "Q11203",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q11203"
}
]
}
]
},
{
"uniprot_ac": "Q11204",
"gene_name": "St3gal2",
"activity": [
{
"ec_number": "2.4.3.2",
"activity": "CMP-N-acetyl-beta-neuraminate + ganglioside GM1 (d18:1(4E)) = CMP + ganglioside GD1a (d18:1(4E)) + H(+).",
"evidence": [
{
"id": "Q11204",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q11204"
}
]
},
{
"ec_number": "2.4.3.4",
"activity": "a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+).",
"evidence": [
{
"id": "Q11204",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q11204"
}
]
},
{
"ec_number": "2.4.3.4",
"activity": "",
"evidence": [
{
"id": "Q11204",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q11204"
}
]
}
]
},
{
"uniprot_ac": "Q11205",
"gene_name": "St3gal2",
"activity": [
{
"ec_number": "2.4.3.2",
"activity": "CMP-N-acetyl-beta-neuraminate + ganglioside GM1 (d18:1(4E)) = CMP + ganglioside GD1a (d18:1(4E)) + H(+).",
"evidence": [
{
"id": "Q11205",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q11205"
}
]
},
{
"ec_number": "2.4.3.4",
"activity": "a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+).",
"evidence": [
{
"id": "Q11205",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q11205"
}
]
},
{
"ec_number": "2.4.3.4",
"activity": "",
"evidence": [
{
"id": "Q11205",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q11205"
}
]
}
]
},
{
"uniprot_ac": "Q11206",
"gene_name": "ST3GAL4",
"activity": [
{
"ec_number": "2.4.3.2",
"activity": "CMP-N-acetyl-beta-neuraminate + ganglioside GM1 (d18:1(4E)) = CMP + ganglioside GD1a (d18:1(4E)) + H(+).",
"evidence": [
{
"id": "Q11206",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q11206"
}
]
},
{
"ec_number": "2.4.3.4",
"activity": "a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+).",
"evidence": [
{
"id": "Q11206",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q11206"
}
]
},
{
"ec_number": "2.4.3.6",
"activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP + H(+).",
"evidence": [
{
"id": "Q11206",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q11206"
}
]
},
{
"ec_number": "2.4.3.2",
"activity": "",
"evidence": [
{
"id": "Q11206",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q11206"
}
]
},
{
"ec_number": "2.4.3.4",
"activity": "",
"evidence": [
{
"id": "Q11206",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q11206"
}
]
}
]
},
{
"uniprot_ac": "Q16842",
"gene_name": "ST3GAL2",
"activity": [
{
"ec_number": "2.4.3.2",
"activity": "CMP-N-acetyl-beta-neuraminate + ganglioside GM1 (d18:1(4E)) = CMP + ganglioside GD1a (d18:1(4E)) + H(+).",
"evidence": [
{
"id": "Q16842",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
]
},
{
"ec_number": "2.4.3.4",
"activity": "a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+).",
"evidence": [
{
"id": "Q16842",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
]
},
{
"ec_number": "2.4.3.4",
"activity": "",
"evidence": [
{
"id": "Q16842",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16842"
}
]
}
]
},
{
"uniprot_ac": "Q8NDV1",
"gene_name": "ST6GALNAC3",
"activity": [
{
"ec_number": "2.4.3.7",
"activity": "an alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-D-GlcNAc derivative + CMP-N-acetyl-beta-neuraminate = an alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->6)]-D-GlcNAc-R + CMP + H(+).",
"evidence": [
{
"id": "Q8NDV1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8NDV1"
}
]
},
{
"ec_number": "2.4.3.7",
"activity": "",
"evidence": [
{
"id": "Q8NDV1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8NDV1"
}
]
}
]
},
{
"uniprot_ac": "Q91Y74",
"gene_name": "St3gal4",
"activity": [
{
"ec_number": "2.4.3.2",
"activity": "CMP-N-acetyl-beta-neuraminate + ganglioside GM1 (d18:1(4E)) = CMP + ganglioside GD1a (d18:1(4E)) + H(+).",
"evidence": [
{
"id": "Q91Y74",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91Y74"
}
]
},
{
"ec_number": "2.4.3.4",
"activity": "a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+).",
"evidence": [
{
"id": "Q91Y74",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91Y74"
}
]
},
{
"ec_number": "2.4.3.6",
"activity": "a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + CMP + H(+).",
"evidence": [
{
"id": "Q91Y74",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91Y74"
}
]
},
{
"ec_number": "2.4.3.4",
"activity": "",
"evidence": [
{
"id": "Q91Y74",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91Y74"
}
]
},
{
"ec_number": "2.4.3.2",
"activity": "",
"evidence": [
{
"id": "Q91Y74",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91Y74"
}
]
}
]
},
{
"uniprot_ac": "Q9H4F1",
"gene_name": "ST6GALNAC4",
"activity": [
{
"ec_number": "2.4.3.7",
"activity": "an alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-D-GlcNAc derivative + CMP-N-acetyl-beta-neuraminate = an alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->6)]-D-GlcNAc-R + CMP + H(+).",
"evidence": [
{
"id": "Q9H4F1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H4F1"
}
]
},
{
"ec_number": "2.4.3.7",
"activity": "",
"evidence": [
{
"id": "Q9H4F1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H4F1"
}
]
}
]
},
{
"uniprot_ac": "Q9UJ37",
"gene_name": "ST6GALNAC2",
"activity": [
{
"ec_number": "2.4.3.3",
"activity": "a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = a beta-D-galactosyl-(1->3)-[N-acetyl-alpha-neuraminyl-(2->6)]-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+).",
"evidence": [
{
"id": "Q9UJ37",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UJ37"
}
]
},
{
"ec_number": "2.4.3.3",
"activity": "",
"evidence": [
{
"id": "Q9UJ37",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UJ37"
}
]
}
]
},
{
"uniprot_ac": "Q9UNP4",
"gene_name": "ST3GAL5",
"activity": [
{
"ec_number": "2.4.3.9",
"activity": "a beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + CMP-N-acetyl-beta-neuraminate = CMP + ganglioside GM3 (d18:1(4E)) + H(+).",
"evidence": [
{
"id": "Q9UNP4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UNP4"
}
]
},
{
"ec_number": "2.4.3.9",
"activity": "",
"evidence": [
{
"id": "Q9UNP4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9UNP4"
}
]
}
]
},
{
"uniprot_ac": "Q9Y274",
"gene_name": "ST3GAL6",
"activity": [
{
"ec_number": "2.4.99.-",
"activity": "",
"evidence": [
{
"id": "Q9Y274",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y274"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [
{
"glytoucan_ac": "G00241VQ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G00728SN",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G00978GW",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G01437WY",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G01457KB",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G01522FD",
"type": "N-linked",
"subtype": "Complex"
},
{
"glytoucan_ac": "G01674VT",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G02076VP",
"type": "N-linked",
"subtype": "Tetraantennary"
},
{
"glytoucan_ac": "G02150AC",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G02387FV",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G02393LQ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G02539TH",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G02562EQ",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G02942YF",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G03016BW",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G03168RN",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G03266UM",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G03591CN",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G04324CR",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G04512BK",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G05107KY",
"type": "O-linked",
"subtype": "Core 6"
},
{
"glytoucan_ac": "G05278GV",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G05412ZS",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G05690OR",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G05970FR",
"type": "O-linked",
"subtype": "Core 6"
},
{
"glytoucan_ac": "G06577DG",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G06755AP",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G06864JC",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G07098TP",
"type": "N-linked",
"subtype": "Complex"
},
{
"glytoucan_ac": "G07191NE",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G07677VL",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G07680WY",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G07789RJ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G08059ZN",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G08425VQ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G08569VN",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G08866CW",
"type": "N-linked",
"subtype": "Tetraantennary"
},
{
"glytoucan_ac": "G09147XQ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G09425PN",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G09575SG",
"type": "O-linked",
"subtype": "Core 6"
},
{
"glytoucan_ac": "G09678FF",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G09767ET",
"type": "O-linked",
"subtype": "Core 6"
},
{
"glytoucan_ac": "G09781FH",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G09826WW",
"type": "N-linked",
"subtype": "Complex"
},
{
"glytoucan_ac": "G10831FE",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G10924UK",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G10925II",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G10954DW",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G11457RF",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G12428MZ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G13260JU",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G13346PK",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G13382WY",
"type": "N-linked",
"subtype": "Tetraantennary"
},
{
"glytoucan_ac": "G13496UJ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G14431ZQ",
"type": "N-linked",
"subtype": "Tetraantennary"
},
{
"glytoucan_ac": "G14722QE",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G14781HP",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G14942ZU",
"type": "N-linked",
"subtype": "Complex"
},
{
"glytoucan_ac": "G15249CA",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G15648GT",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G15859AU",
"type": "N-linked",
"subtype": "Triantennary"
},
{
"glytoucan_ac": "G17251XF",
"type": "Other",
"subtype": "Other"
},
{
"glytoucan_ac": "G17331IX",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G17527HL",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G18347PA",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G18653BM",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G19212IL",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G19231UV",
"type": "O-linked",
"subtype": "Core 6"
},
{
"glytoucan_ac": "G19664QJ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G19793PI",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G19806ZW",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G20453WS",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G20878US",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G21627CA",
"type": "N-linked",
"subtype": "Complex"
},
{
"glytoucan_ac": "G22385OT",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G23654OQ",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G23866EW",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G24142JB",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G24283IO",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G24293BT",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G24475OY",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G24798BT",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G24856YP",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G25127JU",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G25322NY",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G25416CE",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G25498HI",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G25499LZ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G25977RW",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G26099QT",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G26596ON",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G27071PO",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G27409LG",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G27888XB",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G27889FI",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G28877HV",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G28885XK",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G29014XV",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G29524AT",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G30296PK",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G30392XP",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G30431XW",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G31087MR",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G31948FR",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G32289FM",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G32556JI",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G32590UP",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G32722PR",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G32853SP",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G32998WQ",
"type": "Other",
"subtype": "Other"
},
{
"glytoucan_ac": "G33278DK",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G33415VV",
"type": "N-linked",
"subtype": "Complex"
},
{
"glytoucan_ac": "G33758XE",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G33772BZ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G34863TS",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G35199BM",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G35799DH",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G35945JK",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G36138ZV",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G36191EH",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G36983SB",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G37239FO",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G37354FL",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G38027UF",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G38296RM",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G38421BP",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G38542FY",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G38625SV",
"type": "N-linked",
"subtype": "Complex"
},
{
"glytoucan_ac": "G38979WI",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G39321UZ",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G39624YQ",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G39676NA",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G40289VL",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G40445LE",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G40757HO",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G40799GH",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G41245OZ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G41286JH",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G41836YE",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G42089IU",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G42393CS",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G42531AE",
"type": "Other",
"subtype": "Other"
},
{
"glytoucan_ac": "G42650PV",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G42667BL",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G42772WO",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G43167FQ",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G43220WQ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G43265YA",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G43507KQ",
"type": "N-linked",
"subtype": "Complex"
},
{
"glytoucan_ac": "G43668RJ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G43873MM",
"type": "N-linked",
"subtype": "Tetraantennary"
},
{
"glytoucan_ac": "G44233ST",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G44374JT",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G45086UC",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G45596OR",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G45707SN",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G45718WR",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G45756EL",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G46174KH",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G46754UT",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G46785SS",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G46915JA",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G46945LQ",
"type": "N-linked",
"subtype": "Complex"
},
{
"glytoucan_ac": "G47152AG",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G47307MO",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G47459CP",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G47709SA",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G48064BJ",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G48465YI",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G48503ML",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G48757CJ",
"type": "N-linked",
"subtype": "Triantennary"
},
{
"glytoucan_ac": "G49322HB",
"type": "O-linked",
"subtype": "Core 6"
},
{
"glytoucan_ac": "G49390AT",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G49502SC",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G49844LC",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G50252SB",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G50652EJ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G50802FP",
"type": "O-linked",
"subtype": "Core 6"
},
{
"glytoucan_ac": "G50808YS",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G50896EJ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G50937OW",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G51162XR",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G51586EE",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G51678TA",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G52120NK",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G53064IK",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G53208AY",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G53220ZS",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G53396TS",
"type": "O-linked",
"subtype": "Core 6"
},
{
"glytoucan_ac": "G53472RQ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G53778MF",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G53856PB",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G53869ZZ",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G54076UX",
"type": "N-linked",
"subtype": "Complex"
},
{
"glytoucan_ac": "G54083SI",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G54555CN",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G54741SP",
"type": "Other",
"subtype": "Other"
},
{
"glytoucan_ac": "G54970OI",
"type": "Other",
"subtype": "Other"
},
{
"glytoucan_ac": "G55043JL",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G55144QZ",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G55146EO",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G55638XL",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G55719AB",
"type": "N-linked",
"subtype": "Tetraantennary"
},
{
"glytoucan_ac": "G56186MJ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G56293JI",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G56418NV",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G56529CD",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G57130XG",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G58201OX",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G58293BE",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G58577QT",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G58580BP",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G59155GF",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G59392WK",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G59659CN",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G59674PZ",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G60687DB",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G60731ZH",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G60890ZT",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G60949GI",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G61119KT",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G61780GR",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G62002KG",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G62081IR",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G62217NB",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G62437NU",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G63213PP",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G63317CA",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G63324SB",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G63754TT",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G64008QI",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G64566OC",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G64575OQ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G64577HA",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G64613CO",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G64844ET",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G64965PX",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G65262KR",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G65363PV",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G65408JY",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G65815BT",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G65895VF",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G65955VU",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G66162WI",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G66405LD",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G66489LJ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G66887YI",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G66991YE",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G67042FO",
"type": "N-linked",
"subtype": "Tetraantennary"
},
{
"glytoucan_ac": "G67174VO",
"type": "Other",
"subtype": "Other"
},
{
"glytoucan_ac": "G67405DY",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G67549HD",
"type": "N-linked",
"subtype": "Complex"
},
{
"glytoucan_ac": "G67612NO",
"type": "N-linked",
"subtype": "Tetraantennary"
},
{
"glytoucan_ac": "G67693JC",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G67775HG",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G67883AD",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G67920QO",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G68391RZ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G68614NL",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G68806LA",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G69052CM",
"type": "O-linked",
"subtype": "Core 6"
},
{
"glytoucan_ac": "G69065FL",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G69762TP",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G69897TU",
"type": "O-linked",
"subtype": "Core 6"
},
{
"glytoucan_ac": "G70590VH",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G71121NN",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G71409LF",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G71713QS",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G72289FX",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G72304KR",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G72336LC",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G72446TS",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G74114HO",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G74130BZ",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G74241QD",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G74396CO",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G74607VK",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G74701OU",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G75407RU",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G75500ME",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G75786FQ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G75853FN",
"type": "N-linked",
"subtype": "Complex"
},
{
"glytoucan_ac": "G76544YY",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G76705YY",
"type": "N-linked",
"subtype": "Tetraantennary"
},
{
"glytoucan_ac": "G76986FH",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G77149IZ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G77557JA",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G77938VI",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G78315BS",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G79302PB",
"type": "N-linked",
"subtype": "Tetraantennary"
},
{
"glytoucan_ac": "G80068SW",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G80176YK",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G80643JD",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G80951VR",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G81112MA",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G81272FZ",
"type": "Other",
"subtype": "Other"
},
{
"glytoucan_ac": "G81628EZ",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G82133EG",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G82195SF",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G82700SN",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G82785ZH",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G82841UV",
"type": "N-linked",
"subtype": "Complex"
},
{
"glytoucan_ac": "G82862JX",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G82952OK",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G83261UB",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G83546KK",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G83754KL",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G83831AS",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G83998HE",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G84515GE",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G85670FA",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G85907UO",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G86199GK",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G86372GF",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G86669AN",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G88188XI",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G88609PK",
"type": "O-linked",
"subtype": "Core 6"
},
{
"glytoucan_ac": "G88696BY",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G89242LQ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G89597IJ",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G89798IM",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G90135ZJ",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G90436CB",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G91069QW",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G91144VS",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G91313DF",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G92115PW",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G92175OV",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G92354TO",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G92399AI",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G92829RR",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G93239VC",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G93612YS",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G93839ET",
"type": "N-linked",
"subtype": "Triantennary"
},
{
"glytoucan_ac": "G94938LU",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G94941PK",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G95081JK",
"type": "N-linked",
"subtype": "Tetraantennary"
},
{
"glytoucan_ac": "G95304AA",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G95430GC",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G96079CK",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G96336FY",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G96644ZT",
"type": "N-linked",
"subtype": "Complex"
},
{
"glytoucan_ac": "G96758WF",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G97271OF",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G97316FN",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G97345NY",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G97841LZ",
"type": "O-linked",
"subtype": "Core 4"
},
{
"glytoucan_ac": "G98127AN",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G98445EF",
"type": "N-linked",
"subtype": "Tetraantennary"
},
{
"glytoucan_ac": "G98817QU",
"type": "O-linked",
"subtype": "Core 3"
},
{
"glytoucan_ac": "G98906WL",
"type": "N-linked",
"subtype": "Tetraantennary"
},
{
"glytoucan_ac": "G98925GS",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G99244AI",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G99730GF",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G99738HT",
"type": "O-linked",
"subtype": "Core 2"
},
{
"glytoucan_ac": "G99954GW",
"type": "N-linked",
"subtype": "Complex"
},
{
"glytoucan_ac": "G99987ZQ",
"type": "O-linked",
"subtype": "Core 2"
}
],
"cluster_types": [
{
"name": "homologset.mgi",
"label": "MGI Homologs"
},
{
"name": "homologset.oma",
"label": "OMA Homologs"
}
],
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 4
},
{
"field": "total_sites",
"count": 2
},
{
"field": "n_linked_glycans",
"count": 2
},
{
"field": "n_linked_glycan_sites",
"count": 3
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 2
},
{
"field": "total_sites",
"count": 2
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 2
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 2
},
{
"field": "total_sites",
"count": 1
},
{
"field": "n_linked_glycans",
"count": 2
},
{
"field": "n_linked_glycan_sites",
"count": 1
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 3
},
{
"field": "total_sites",
"count": 3
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl"
]
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 3
},
{
"field": "total_sites",
"count": 3
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl"
]
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 92
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}