{ "uniprot_canonical_ac": "Q15109-1", "uniprot_ac": "Q15109", "uniprot_id": "RAGE_HUMAN", "mass": { "chemical_mass": 42803.0, "monoisotopic_mass": 42803.0 }, "refseq": { "ac": "NP_001127", "name": "advanced glycosylation end product-specific receptor isoform 1 precursor", "summary": "The advanced glycosylation end product (AGE) receptor encoded by this gene is a member of the immunoglobulin superfamily of cell surface receptors. It is a multiligand receptor, and besides AGE, interacts with other molecules implicated in homeostasis, development, and inflammation, and certain diseases, such as diabetes and Alzheimer's disease. Many alternatively spliced transcript variants encoding different isoforms, as well as non-protein-coding variants, have been described for this gene (PMID:18089847). [provided by RefSeq, May 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127" }, "gene_names": [ { "name": "AGER", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q15109", "id": "Q15109" }, { "name": "AGER", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127", "id": "NP_001127" }, { "name": "RAGE; SCARJ1; sRAGE", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127", "id": "NP_001127" }, { "name": "RAGE", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q15109", "id": "Q15109" } ], "protein_names": [ { "name": "Advanced glycosylation end product-specific receptor", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q15109" }, { "name": "Receptor for advanced glycosylation end products", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q15109" }, { "name": "advanced glycosylation end product-specific receptor isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127", "id": "NP_001127" }, { "name": "receptor for advanced glycation end-products", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127", "id": "NP_001127" } ], "function": [ { "annotation": "Advanced Glycation End Products' Receptor DNA Methylation Associated with Immune Infiltration and Prognosis of Lung Adenocarcinoma and Lung Squamous Cell Carcinoma. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127" }, { "database": "PubMed", "id": "37497166", "url": "https://glygen.org/publication/PubMed/37497166" } ] }, { "annotation": "Alpha cell receptor for advanced glycation end products associate with glucagon expression in type 1 diabetes. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127" }, { "database": "PubMed", "id": "37558746", "url": "https://glygen.org/publication/PubMed/37558746" } ] }, { "annotation": "Cell surface pattern recognition receptor that senses endogenous stress signals with a broad ligand repertoire including advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids and glycosaminoglycans (PubMed:27572515, PubMed:28515150, PubMed:34743181). Advanced glycosylation end products are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes (PubMed:21565706). These ligands accumulate at inflammatory sites during the pathogenesis of various diseases, including diabetes, vascular complications, neurodegenerative disorders, and cancers and RAGE transduces their binding into pro-inflammatory responses. Upon ligand binding, uses TIRAP and MYD88 as adapters to transduce the signal ultimately leading to the induction or inflammatory cytokines IL6, IL8 and TNFalpha through activation of NF-kappa-B (PubMed:21829704). Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key pro-inflammatory mediators (PubMed:19386136). Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons (PubMed:19906677). ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space. Participates in endothelial albumin transcytosis together with HMGB1 through the RAGE/SRC/Caveolin-1 pathway, leading to endothelial hyperpermeability (PubMed:27572515). Mediates the loading of HMGB1 in extracellular vesicles (EVs) that shuttle HMGB1 to hepatocytes by transferrin-mediated endocytosis and subsequently promote hepatocyte pyroptosis by activating the NLRP3 inflammasome (PubMed:34743181). Promotes also extracellular hypomethylated DNA (CpG DNA) uptake by cells via the endosomal route to activate inflammatory responses (PubMed:24081950, PubMed:28515150).", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109#function" }, { "database": "PubMed", "id": "21565706", "url": "https://glygen.org/publication/PubMed/21565706" }, { "database": "PubMed", "id": "19906677", "url": "https://glygen.org/publication/PubMed/19906677" }, { "database": "PubMed", "id": "21559403", "url": "https://glygen.org/publication/PubMed/21559403" }, { "database": "PubMed", "id": "27572515", "url": "https://glygen.org/publication/PubMed/27572515" }, { "database": "PubMed", "id": "28515150", "url": "https://glygen.org/publication/PubMed/28515150" }, { "database": "PubMed", "id": "21829704", "url": "https://glygen.org/publication/PubMed/21829704" }, { "database": "PubMed", "id": "20943659", "url": "https://glygen.org/publication/PubMed/20943659" }, { "database": "UniProtKB", "id": "Q62151", "url": "https://www.uniprot.org/uniprot/Q62151#function" }, { "database": "PubMed", "id": "34743181", "url": "https://glygen.org/publication/PubMed/34743181" }, { "database": "PubMed", "id": "24081950", "url": "https://glygen.org/publication/PubMed/24081950" } ] }, { "annotation": "Low expression of endogenous secretory RAGE in the hippocampus would be associated with the development of Alzheimer's disease", "evidence": [ { "database": "RefSeq", "id": "NP_001127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127" }, { "database": "PubMed", "id": "18431028", "url": "https://glygen.org/publication/PubMed/18431028" } ] }, { "annotation": "RAGE inhibition blunts insulin-induced oncogenic signals in breast cancer. Erratum:[Breast Cancer Res. 2023 Aug 10;25(1):94. PMID: 37563657] Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127" }, { "database": "PubMed", "id": "37461077", "url": "https://glygen.org/publication/PubMed/37461077" } ] }, { "annotation": "RAGE_v1 variant is the primary secreted soluble isoform of RAGE. identification of functional splice variants of RAGE underscores biological diversity of the RAGE gene & will aid in understanding of the gene in the normal & pathological state.", "evidence": [ { "database": "RefSeq", "id": "NP_001127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127" }, { "database": "PubMed", "id": "18089847", "url": "https://glygen.org/publication/PubMed/18089847" } ] }, { "annotation": "Soluble RAGE and skeletal muscle tissue RAGE expression profiles in lean and obese young adults across differential aerobic exercise intensities.", "evidence": [ { "database": "RefSeq", "id": "NP_001127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127" }, { "database": "PubMed", "id": "37675469", "url": "https://glygen.org/publication/PubMed/37675469" } ] }, { "annotation": "The advanced glycosylation end product (AGE) receptor encoded by this gene is a member of the immunoglobulin superfamily of cell surface receptors. It is a multiligand receptor, and besides AGE, interacts with other molecules implicated in homeostasis, development, and inflammation, and certain diseases, such as diabetes and Alzheimer's disease. Many alternatively spliced transcript variants encoding different isoforms, as well as non-protein-coding variants, have been described for this gene (PMID:18089847). [provided by RefSeq, May 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_001127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1437325653", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1437325653" }, { "id": "rs1437325653", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1437325653#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 27, "end_pos": 27, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->NII).", "chr_id": "6", "chr_pos": "32183960", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T27", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1361657410", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1361657410" }, { "id": "rs1361657410", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1361657410" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 56, "end_pos": 56, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTG->NTS).", "chr_id": "6", "chr_pos": "32183744", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G56", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs766755123", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766755123" }, { "id": "rs766755123", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766755123" }, { "id": "rs766755123", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766755123" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 81, "end_pos": 81, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->HGS).", "chr_id": "6", "chr_pos": "32183669", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N81", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1044599245", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1044599245" }, { "id": "rs1044599245", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1044599245#frequency_tab" }, { "id": "rs1044599245", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1044599245" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 81, "end_pos": 81, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "6", "chr_pos": "32183668", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N81", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 374, "end_pos": 374, "sequence_org": "K", "sequence_mut": "R", "comment": "Less monoubiquitinated product and resistant to degradation.", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" }, { "database": "PubMed", "id": "28515150", "url": "https://glygen.org/publication/PubMed/28515150" } ] }, { "start_pos": 391, "end_pos": 391, "sequence_org": "S", "sequence_mut": "A", "comment": "Complete loss of phosphorylation by PKC/PRKCZ.", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" }, { "database": "PubMed", "id": "21829704", "url": "https://glygen.org/publication/PubMed/21829704" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "72.84", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000204305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204305" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "61.05", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000204305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204305" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "68.43", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000204305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204305" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "61.91", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000204305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204305" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "85.73", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000204305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204305" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "82.11", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000204305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204305" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "59.04", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000204305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204305" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "73.46", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000204305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204305" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "93.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000204305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204305" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "98.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000204305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204305" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "71.71", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000204305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204305" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "88.72", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000204305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204305" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "80.66", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000204305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204305" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "Q15109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q15109" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "Q15109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q15109" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "Q15109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q15109" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "Q15109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q15109" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "Q15109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q15109" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "Q15109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q15109" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "Q15109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q15109" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "Q15109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q15109" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "Q15109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q15109" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "Q15109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q15109" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "Q15109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q15109" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "Q15109", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q15109" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "common_name": "Human" } ], "gene": [ { "name": "AGER", "url": "https://www.uniprot.org/uniprot/Q15109", "locus": { "chromosome": "CHR_HSCHR6_MHC_MANN_CTG1", "start_pos": 32220356, "end_pos": 32223712, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000229058", "url": "https://www.ensembl.org/id/ENSG00000229058" } ] } } ], "crossref": [ { "id": "ENSG00000204305", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204305", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00096", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00096", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2176846", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2176846", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "AGER", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=AGER", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "177", "url": "https://www.ncbi.nlm.nih.gov/gene/177", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "320", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=320", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "Q15109", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q15109*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003006", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003006", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013151", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013151", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013162", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013162", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:177", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:177", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "600214", "url": "http://www.omim.org/entry/600214", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_Q15109", "url": "https://www.nextprot.org/entry/NX_Q15109", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "HPSHEPQ", "url": "https://omabrowser.org/oma/group/HPSHEPQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4637563at2759", "url": "http://www.orthodb.org/?query=4637563at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11973", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11973", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11973:SF20", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11973:SF20", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2E5E", "url": "https://www.rcsb.org/structure/2E5E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2ENS", "url": "https://www.rcsb.org/structure/2ENS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2L7U", "url": "https://www.rcsb.org/structure/2L7U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LE9", "url": "https://www.rcsb.org/structure/2LE9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2LMB", "url": "https://www.rcsb.org/structure/2LMB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2M1K", "url": "https://www.rcsb.org/structure/2M1K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MJW", "url": "https://www.rcsb.org/structure/2MJW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MOV", "url": "https://www.rcsb.org/structure/2MOV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3CJJ", "url": "https://www.rcsb.org/structure/3CJJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3O3U", "url": "https://www.rcsb.org/structure/3O3U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4LP4", "url": "https://www.rcsb.org/structure/4LP4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4LP5", "url": "https://www.rcsb.org/structure/4LP5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4OF5", "url": "https://www.rcsb.org/structure/4OF5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4OFV", "url": "https://www.rcsb.org/structure/4OFV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4OI7", "url": "https://www.rcsb.org/structure/4OI7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4OI8", "url": "https://www.rcsb.org/structure/4OI8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4P2Y", "url": "https://www.rcsb.org/structure/4P2Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4XYN", "url": "https://www.rcsb.org/structure/4XYN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4YBH", "url": "https://www.rcsb.org/structure/4YBH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5D7F", "url": "https://www.rcsb.org/structure/5D7F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6VXG", "url": "https://www.rcsb.org/structure/6VXG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6XQ1", "url": "https://www.rcsb.org/structure/6XQ1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6XQ3", "url": "https://www.rcsb.org/structure/6XQ3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6XQ5", "url": "https://www.rcsb.org/structure/6XQ5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6XQ6", "url": "https://www.rcsb.org/structure/6XQ6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6XQ7", "url": "https://www.rcsb.org/structure/6XQ7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6XQ8", "url": "https://www.rcsb.org/structure/6XQ8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6XQ9", "url": "https://www.rcsb.org/structure/6XQ9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LML", "url": "https://www.rcsb.org/structure/7LML", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LMW", "url": "https://www.rcsb.org/structure/7LMW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00047", "url": "http://pfam.xfam.org/family/PF00047", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08205", "url": "http://pfam.xfam.org/family/PF08205", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13895", "url": "http://pfam.xfam.org/family/PF13895", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13927", "url": "http://pfam.xfam.org/family/PF13927", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "Q15109", "url": "https://pharos.nih.gov/targets/Q15109", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_Q15109", "url": "http://purl.obolibrary.org/obo/PR_Q15109", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-879415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-933542", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933542", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0G2JID9", "url": "https://www.uniprot.org/uniprot/A0A0G2JID9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JID9-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JID9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JJF5", "url": "https://www.uniprot.org/uniprot/A0A0G2JJF5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JJF5-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JJF5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JJW2", "url": "https://www.uniprot.org/uniprot/A0A0G2JJW2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JJW2-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JJW2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JKB6", "url": "https://www.uniprot.org/uniprot/A0A0G2JKB6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JKB6-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JKB6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JL21", "url": "https://www.uniprot.org/uniprot/A0A0G2JL21", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JL21-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JL21-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JL23", "url": "https://www.uniprot.org/uniprot/A0A0G2JL23", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JL23-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JL23-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JL37", "url": "https://www.uniprot.org/uniprot/A0A0G2JL37", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JL37-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JL37-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JL65", "url": "https://www.uniprot.org/uniprot/A0A0G2JL65", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JL65-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JL65-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8MS87", "url": "https://www.uniprot.org/uniprot/A8MS87", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A8MS87-1", "url": "https://www.uniprot.org/uniprot/A8MS87-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B5A982", "url": "https://www.uniprot.org/uniprot/B5A982", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B5A982-1", "url": "https://www.uniprot.org/uniprot/B5A982-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C0IP14", "url": "https://www.uniprot.org/uniprot/C0IP14", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C0IP14-1", "url": "https://www.uniprot.org/uniprot/C0IP14-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q15109-1", "url": "https://www.uniprot.org/uniprot/Q15109-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q15109-10", "url": "https://www.uniprot.org/uniprot/Q15109-10", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q15109-2", "url": "https://www.uniprot.org/uniprot/Q15109-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q15109-3", "url": "https://www.uniprot.org/uniprot/Q15109-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q15109-4", "url": "https://www.uniprot.org/uniprot/Q15109-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q15109-5", "url": "https://www.uniprot.org/uniprot/Q15109-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q15109-6", "url": "https://www.uniprot.org/uniprot/Q15109-6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q15109-7", "url": "https://www.uniprot.org/uniprot/Q15109-7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q15109-8", "url": "https://www.uniprot.org/uniprot/Q15109-8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q15109-9", "url": "https://www.uniprot.org/uniprot/Q15109-9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3L1R2", "url": "https://www.uniprot.org/uniprot/Q3L1R2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q3L1R2-1", "url": "https://www.uniprot.org/uniprot/Q3L1R2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5SSZ2", "url": "https://www.uniprot.org/uniprot/Q5SSZ2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5SSZ2-1", "url": "https://www.uniprot.org/uniprot/Q5SSZ2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5SSZ3", "url": "https://www.uniprot.org/uniprot/Q5SSZ3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5SSZ3-1", "url": "https://www.uniprot.org/uniprot/Q5SSZ3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP", "length": 404, "header": "sp|Q15109-1|RAGE_HUMAN Isoform 1 of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JID9-1", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLGGGPWDSVARVLPNSSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDVSDLERGAGRTRRGGANCRLCGRIRAGNSSPGPGDPGRPGDSRPAHWGHLVAKAATPRRGEEGPRKPGGRGGACRTESVGGT", "length": 342, "header": "tr|A0A0G2JID9-1|A0A0G2JID9_HUMAN Computationally mapped isoform of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": { "chromosome": "CHR_HSCHR6_MHC_APD_CTG1", "start_pos": 32251231, "end_pos": 32248186, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000424145.6", "url": "https://www.ensembl.org/id/ENST00000424145.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000391970.2", "url": "https://www.ensembl.org/id/ENSP00000391970.2" } ] } }, { "isoform_ac": "A0A0G2JJF5-1", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNSSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGEGFDKVREAEDSPQHM", "length": 347, "header": "tr|A0A0G2JJF5-1|RAGE_HUMAN Computationally mapped isoform of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": { "chromosome": "CHR_HSCHR6_MHC_MCF_CTG1", "start_pos": 32260648, "end_pos": 32257982, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000452945.5", "url": "https://www.ensembl.org/id/ENST00000452945.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000403322.1", "url": "https://www.ensembl.org/id/ENSP00000403322.1" } ] } }, { "isoform_ac": "A0A0G2JJW2-1", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNSSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVVEESRRSRKRPCEQEVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRH", "length": 233, "header": "tr|A0A0G2JJW2-1|A0A0G2JJW2_HUMAN Computationally mapped isoform of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": { "chromosome": "CHR_HSCHR6_MHC_MCF_CTG1", "start_pos": 32260648, "end_pos": 32259307, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000412794.5", "url": "https://www.ensembl.org/id/ENST00000412794.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000397350.1", "url": "https://www.ensembl.org/id/ENSP00000397350.1" } ] } }, { "isoform_ac": "A0A0G2JKB6-1", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNSSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRSLRTFTITASDWIFPPSEIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALR", "length": 234, "header": "tr|A0A0G2JKB6-1|A0A0G2JKB6_HUMAN Computationally mapped isoform of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": { "chromosome": "CHR_HSCHR6_MHC_MCF_CTG1", "start_pos": 32260648, "end_pos": 32259295, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000436653.5", "url": "https://www.ensembl.org/id/ENST00000436653.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000388041.1", "url": "https://www.ensembl.org/id/ENSP00000388041.1" } ] } }, { "isoform_ac": "A0A0G2JL21-1", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNSSLFLPAVGIQDEGILGGLGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP", "length": 153, "header": "tr|A0A0G2JL21-1|RAGE_HUMAN Computationally mapped isoform of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": { "chromosome": "CHR_HSCHR6_MHC_MCF_CTG1", "start_pos": 32260648, "end_pos": 32257572, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000552209.5", "url": "https://www.ensembl.org/id/ENST00000552209.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000448142.1", "url": "https://www.ensembl.org/id/ENSP00000448142.1" } ] } }, { "isoform_ac": "A0A0G2JL23-1", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNSSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQFENLHNYSL", "length": 128, "header": "tr|A0A0G2JL23-1|RAGE_HUMAN Computationally mapped isoform of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": { "chromosome": "CHR_HSCHR6_MHC_APD_CTG1", "start_pos": 32251231, "end_pos": 32250421, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000548935.4", "url": "https://www.ensembl.org/id/ENST00000548935.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000448525.1", "url": "https://www.ensembl.org/id/ENSP00000448525.1" } ] } }, { "isoform_ac": "A0A0G2JL37-1", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNSSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVVEESRRSRKRPCEQEVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGEGFDKVREAEDSPQHM", "length": 363, "header": "tr|A0A0G2JL37-1|RAGE_HUMAN Computationally mapped isoform of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": { "chromosome": "CHR_HSCHR6_MHC_APD_CTG1", "start_pos": 32251231, "end_pos": 32248565, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000551378.4", "url": "https://www.ensembl.org/id/ENST00000551378.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000449040.1", "url": "https://www.ensembl.org/id/ENSP00000449040.1" } ] } }, { "isoform_ac": "A0A0G2JL65-1", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNSSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVVEESRRSRKRPCEQEVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP", "length": 420, "header": "tr|A0A0G2JL65-1|A0A0G2JL65_HUMAN Computationally mapped isoform of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": { "chromosome": "CHR_HSCHR6_MHC_MCF_CTG1", "start_pos": 32260648, "end_pos": 32257572, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000549227.5", "url": "https://www.ensembl.org/id/ENST00000549227.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000449731.2", "url": "https://www.ensembl.org/id/ENSP00000449731.2" } ] } }, { "isoform_ac": "A8MS87-1", "url": "", "sequence": { "sequence": "MNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIGSVGGSGLGTLALALGILGGLGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP", "length": 294, "header": "tr|A8MS87-1|RAGE_HUMAN Computationally mapped isoform of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=2 CANONICAL=Q15109-1" }, "locus": { "chromosome": "6", "start_pos": 32183606, "end_pos": 32181146, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000375070.7", "url": "https://www.ensembl.org/id/ENST00000375070.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000364211.4", "url": "https://www.ensembl.org/id/ENSP00000364211.4" } ] } }, { "isoform_ac": "B5A982-1", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQFENLHNYSL", "length": 128, "header": "tr|B5A982-1|RAGE_HUMAN Computationally mapped isoform of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": { "chromosome": "CHR_HSCHR6_MHC_COX_CTG1", "start_pos": 32132693, "end_pos": 32131883, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000548959.5", "url": "https://www.ensembl.org/id/ENST00000548959.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000447095.1", "url": "https://www.ensembl.org/id/ENSP00000447095.1" } ] } }, { "isoform_ac": "C0IP14-1", "url": "", "sequence": { "sequence": "MKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP", "length": 133, "header": "tr|C0IP14-1|RAGE_HUMAN Computationally mapped isoform of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": { "chromosome": "CHR_HSCHR6_MHC_MANN_CTG1", "start_pos": 32221964, "end_pos": 32220534, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000552517.5", "url": "https://www.ensembl.org/id/ENST00000552517.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000446495.1", "url": "https://www.ensembl.org/id/ENSP00000446495.1" } ] } }, { "isoform_ac": "Q15109-1", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP", "length": 404, "header": "sp|Q15109-1|RAGE_HUMAN Isoform 1 of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": { "chromosome": "6", "start_pos": 32184222, "end_pos": 32181146, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000375076.9", "url": "https://www.ensembl.org/id/ENST00000375076.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000364217.4", "url": "https://www.ensembl.org/id/ENSP00000364217.4" } ] } }, { "isoform_ac": "Q15109-10", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGVILWQRRQRRGEERPQKTRRKRRSVQN", "length": 386, "header": "sp|Q15109-10|RAGE_HUMAN Isoform 10 of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": {} }, { "isoform_ac": "Q15109-2", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDVSDLERGAGRTRRGGANCRLCGRIRAGNSSPGPGDPGRPGDSRPAHWGHLVAKAATPRRGEEGPRKPGGRGGACRTESVGGT", "length": 342, "header": "sp|Q15109-2|RAGE_HUMAN Isoform 2 of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": { "chromosome": "CHR_HSCHR6_MHC_MANN_CTG1", "start_pos": 32223610, "end_pos": 32220565, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000412470.6", "url": "https://www.ensembl.org/id/ENST00000412470.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000387853.2", "url": "https://www.ensembl.org/id/ENSP00000387853.2" } ] } }, { "isoform_ac": "Q15109-3", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGEGFDKVREAEDSPQHM", "length": 347, "header": "sp|Q15109-3|RAGE_HUMAN Isoform 3 of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": { "chromosome": "CHR_HSCHR6_MHC_QBL_CTG1", "start_pos": 32141830, "end_pos": 32139164, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000383275.6", "url": "https://www.ensembl.org/id/ENST00000383275.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000372762.2", "url": "https://www.ensembl.org/id/ENSP00000372762.2" } ] } }, { "isoform_ac": "Q15109-4", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVVEESRRSRKRPCEQEVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGEGFDKVREAEDSPQHM", "length": 363, "header": "sp|Q15109-4|RAGE_HUMAN Isoform 4 of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": { "chromosome": "CHR_HSCHR6_MHC_SSTO_CTG1", "start_pos": 32191894, "end_pos": 32189228, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000551827.4", "url": "https://www.ensembl.org/id/ENST00000551827.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000449042.1", "url": "https://www.ensembl.org/id/ENSP00000449042.1" } ] } }, { "isoform_ac": "Q15109-5", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNWWWSQKVEQ", "length": 121, "header": "sp|Q15109-5|RAGE_HUMAN Isoform 5 of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": {} }, { "isoform_ac": "Q15109-6", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVVEESRRSRKRPCEQEVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP", "length": 420, "header": "sp|Q15109-6|RAGE_HUMAN Isoform 6 of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": { "chromosome": "CHR_HSCHR6_MHC_COX_CTG1", "start_pos": 32132693, "end_pos": 32129617, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000548464.3", "url": "https://www.ensembl.org/id/ENST00000548464.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000450134.2", "url": "https://www.ensembl.org/id/ENSP00000450134.2" } ] } }, { "isoform_ac": "Q15109-7", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP", "length": 390, "header": "sp|Q15109-7|RAGE_HUMAN Isoform 7 of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": {} }, { "isoform_ac": "Q15109-8", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDNQARRGQLQVRGLIKSGKQKIAPNTCDWGDGQQERNGRPQKTRRKRRSVQN", "length": 325, "header": "sp|Q15109-8|RAGE_HUMAN Isoform 8 of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": {} }, { "isoform_ac": "Q15109-9", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGLRTREPTAVWPPIPATGPRKAVLSASASSNQARRGQLQVRGLIKSGKQKIAPNTCDWGDGQQERNGRPQKTRRKRRSVQN", "length": 355, "header": "sp|Q15109-9|RAGE_HUMAN Isoform 9 of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": {} }, { "isoform_ac": "Q3L1R2-1", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGILGGLGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP", "length": 153, "header": "tr|Q3L1R2-1|RAGE_HUMAN Computationally mapped isoform of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1 CANONICAL=Q15109-1" }, "locus": { "chromosome": "CHR_HSCHR6_MHC_QBL_CTG1", "start_pos": 32141830, "end_pos": 32138754, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000548034.3", "url": "https://www.ensembl.org/id/ENST00000548034.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000449037.1", "url": "https://www.ensembl.org/id/ENSP00000449037.1" } ] } }, { "isoform_ac": "Q5SSZ2-1", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVVEESRRSRKRPCEQEVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRH", "length": 233, "header": "tr|Q5SSZ2-1|Q5SSZ2_HUMAN Computationally mapped isoform of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=2 CANONICAL=Q15109-1" }, "locus": { "chromosome": "CHR_HSCHR6_MHC_SSTO_CTG1", "start_pos": 32191894, "end_pos": 32190553, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000441753.5", "url": "https://www.ensembl.org/id/ENST00000441753.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000410918.1", "url": "https://www.ensembl.org/id/ENSP00000410918.1" } ] } }, { "isoform_ac": "Q5SSZ3-1", "url": "", "sequence": { "sequence": "MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRSLRTFTITASDWIFPPSEIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALR", "length": 234, "header": "tr|Q5SSZ3-1|Q5SSZ3_HUMAN Computationally mapped isoform of Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=2 CANONICAL=Q15109-1" }, "locus": { "chromosome": "CHR_HSCHR6_MHC_COX_CTG1", "start_pos": 32132693, "end_pos": 32131340, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000455471.5", "url": "https://www.ensembl.org/id/ENST00000455471.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000391024.1", "url": "https://www.ensembl.org/id/ENSP00000391024.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 25, "start_aa": "Asn", "end_pos": 25, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn25", "evidence": [ { "id": "Q15109", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15109#ptm_processing" }, { "id": "21511948", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/21511948" }, { "id": "21511948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21511948" }, { "id": "30612271", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/30612271" }, { "id": "30612271", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30612271" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 81, "start_aa": "Asn", "end_pos": 81, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn81", "evidence": [ { "id": "Q15109", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15109#ptm_processing" }, { "id": "33119615", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/33119615" }, { "id": "33119615", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33119615" }, { "id": "21511948", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/21511948" }, { "id": "21511948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21511948" }, { "id": "30612271", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/30612271" }, { "id": "30612271", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30612271" }, { "id": "17714874", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/17714874" }, { "id": "17714874", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17714874" } ] } ], "phosphorylation": [ { "start_pos": 391, "end_pos": 391, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC/PRKCZ", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" }, { "database": "iPTMnet", "id": "Q15109", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15109" }, { "database": "PubMed", "id": "21829704", "url": "https://glygen.org/publication/PubMed/21829704" } ], "site_lbl": "Ser391" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported" ], "publication": [ { "title": "N(epsilon)-(carboxymethyl)lysine adducts of proteins are ligands for receptor for advanced glycation end products that activate cell signaling pathways and modulate gene expression.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Kislinger T, Fu C, Huber B, Qu W, Taguchi A, Du Yan S, Hofmann M, Yan SF, Pischetsrieder M, Stern D, Schmidt AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-879415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415" } ], "reference": [ { "type": "PubMed", "id": "10531386", "url": "https://glygen.org/publication/PubMed/10531386" } ] }, { "title": "Activation of NF-kappa B by the dsRNA-dependent protein kinase, PKR involves the I kappa B kinase complex.", "journal": "Oncogene", "date": "2000", "authors": "Gil J, Alcami J, Esteban M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "10723127", "url": "https://glygen.org/publication/PubMed/10723127" } ] }, { "title": "Effects of novel polymorphisms in the RAGE gene on transcriptional regulation and their association with diabetic retinopathy.", "journal": "Diabetes", "date": "2001", "authors": "Grant P.J., Futers T.S., Hudson B.I., Stickland M.H.", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "reference": [ { "type": "PubMed", "id": "11375354", "url": "https://glygen.org/publication/PubMed/11375354" } ] }, { "title": "IKKalpha, IKKbeta, and NEMO/IKKgamma are each required for the NF-kappa B-mediated inflammatory response program.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Li X, Massa PE, Hanidu A, Peet GW, Aro P, Savitt A, Mische S, Li J, Marcu KB", "evidence": [ { "database": "Reactome", "id": "R-HSA-933542", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933542" } ], "reference": [ { "type": "PubMed", "id": "12221085", "url": "https://glygen.org/publication/PubMed/12221085" } ] }, { "title": "Solution NMR structure of S100B bound to the high-affinity target peptide TRTK-12.", "journal": "Journal of molecular biology", "date": "2002", "authors": "Inman KG, Yang R, Rustandi RR, Miller KE, Baldisseri DM, Weber DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-879415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415" } ], "reference": [ { "type": "PubMed", "id": "12470955", "url": "https://glygen.org/publication/PubMed/12470955" } ] }, { "title": "Novel splice variants of the receptor for advanced glycation end-products expressed in human vascular endothelial cells and pericytes, and their putative roles in diabetes-induced vascular injury.", "journal": "Biochem. J.", "date": "2003", "authors": "Li H., Watanabe T., Yamamoto H., Yamamoto Y., Okamoto H., Takeuchi M., Takasawa S., Yonekura H., Yasui K., Sakurai S., Abedin J., Makita Z., Petrova R.G.", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "reference": [ { "type": "PubMed", "id": "12495433", "url": "https://glygen.org/publication/PubMed/12495433" } ] }, { "title": "The receptor for advanced glycation end-products (RAGE) directly binds to ERK by a D-domain-like docking site.", "journal": "FEBS letters", "date": "2003", "authors": "Ishihara K, Tsutsumi K, Kawane S, Nakajima M, Kasaoka T", "evidence": [ { "database": "Reactome", "id": "R-HSA-879415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415" } ], "reference": [ { "type": "PubMed", "id": "12935895", "url": "https://glygen.org/publication/PubMed/12935895" } ] }, { "title": "Cloning and expression of a cell surface receptor for advanced glycosylation end products of proteins.", "journal": "J. Biol. Chem.", "date": "1992", "authors": "Stern D., Wang F., Yan S.D., Brett J., Elliston K., Shaw A., Pan Y.C., Neeper M., Schmidt A.M.", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "reference": [ { "type": "PubMed", "id": "1378843", "url": "https://glygen.org/publication/PubMed/1378843" } ] }, { "title": "Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.", "journal": "Genome Res.", "date": "2003", "authors": "Xie T, Rowen L, Aguado B, Ahearn ME, Madan A, Qin S, Campbell RD, Hood L", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "reference": [ { "type": "PubMed", "id": "14656967", "url": "https://glygen.org/publication/PubMed/14656967" } ] }, { "title": "The two NF-kappaB activation pathways and their role in innate and adaptive immunity.", "journal": "Trends in immunology", "date": "2004", "authors": "Bonizzi G, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "15145317", "url": "https://glygen.org/publication/PubMed/15145317" } ] }, { "title": "Ubiquitin signalling in the NF-kappaB pathway.", "journal": "Nature cell biology", "date": "2005", "authors": "Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "16056267", "url": "https://glygen.org/publication/PubMed/16056267" } ] }, { "title": "Two novel rat liver membrane proteins that bind advanced glycosylation endproducts: relationship to macrophage receptor for glucose-modified proteins.", "journal": "The Journal of experimental medicine", "date": "1991", "authors": "Yang Z, Makita Z, Horii Y, Brunelle S, Cerami A, Sehajpal P, Suthanthiran M, Vlassara H", "evidence": [ { "database": "Reactome", "id": "R-HSA-879415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415" } ], "reference": [ { "type": "PubMed", "id": "1651976", "url": "https://glygen.org/publication/PubMed/1651976" } ] }, { "title": "Regulation and function of IKK and IKK-related kinases.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2006", "authors": "Hacker H, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "17047224", "url": "https://glygen.org/publication/PubMed/17047224" } ] }, { "title": "De-N-glycosylation or G82S mutation of RAGE sensitizes its interaction with advanced glycation endproducts.", "journal": "Biochimica et biophysica acta", "date": "2007", "authors": "Osawa M, Yamamoto Y, Munesue S, Murakami N, Sakurai S, Watanabe T, Yonekura H, Uchigata Y, Iwamoto Y, Yamamoto H", "evidence": [ { "database": "Automatic Literature Mining", "id": "17714874", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/17714874" } ], "reference": [ { "type": "PubMed", "id": "17714874", "url": "https://glygen.org/publication/PubMed/17714874" } ] }, { "title": "Identification of TRAF6-dependent NEMO polyubiquitination sites through analysis of a new NEMO mutation causing incontinentia pigmenti.", "journal": "Human molecular genetics", "date": "2007", "authors": "Sebban-Benin H, Pescatore A, Fusco F, Pascuale V, Gautheron J, Yamaoka S, Moncla A, Ursini MV, Courtois G", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "17728323", "url": "https://glygen.org/publication/PubMed/17728323" } ] }, { "title": "Identification, classification, and expression of RAGE gene splice variants.", "journal": "FASEB J.", "date": "2008", "authors": "Hudson BI, Carter AM, Harja E, Kalea AZ, Arriero M, Yang H, Grant PJ, Schmidt AM", "evidence": [ { "database": "UniProtKB", "id": "Q3L1R2", "url": "https://www.uniprot.org/uniprot/Q3L1R2" }, { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" }, { "database": "RefSeq", "id": "NP_001127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127" } ], "reference": [ { "type": "PubMed", "id": "18089847", "url": "https://glygen.org/publication/PubMed/18089847" } ] }, { "title": "Reduced expression of endogenous secretory receptor for advanced glycation endproducts in hippocampal neurons of Alzheimer's disease brains.", "journal": "Archives of histology and cytology", "date": "2007", "authors": "Nozaki I, Watanabe T, Kawaguchi M, Akatsu H, Tsuneyama K, Yamamoto Y, Ohe K, Yonekura H, Yamada M, Yamamoto H", "evidence": [ { "database": "RefSeq", "id": "NP_001127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127" } ], "reference": [ { "type": "PubMed", "id": "18431028", "url": "https://glygen.org/publication/PubMed/18431028" } ] }, { "title": "Structure of a NEMO/IKK-associating domain reveals architecture of the interaction site.", "journal": "Structure (London, England : 1993)", "date": "2008", "authors": "Rushe M, Silvian L, Bixler S, Chen LL, Cheung A, Bowes S, Cuervo H, Berkowitz S, Zheng T, Guckian K, Pellegrini M, Lugovskoy A", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "18462684", "url": "https://glygen.org/publication/PubMed/18462684" } ] }, { "title": "Gly82Ser polymorphism of the receptor for advanced glycation end products is associated with an increased risk of gastric cancer in a Chinese population.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2008", "authors": "Gu H, Yang L, Sun Q, Zhou B, Tang N, Cong R, Zeng Y, Wang B", "evidence": [ { "database": "Entrez", "id": "177", "url": "https://www.ncbi.nlm.nih.gov/gene/177" } ], "reference": [ { "type": "PubMed", "id": "18519797", "url": "https://glygen.org/publication/PubMed/18519797" } ] }, { "title": "Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis.", "journal": "Arthritis Res. Ther.", "date": "2008", "authors": "Jin P, Zhang J, Sumariwalla PF, Ni I, Jorgensen B, Crawford D, Phillips S, Feldmann M, Shepard HM, Paleolog EM", "evidence": [ { "database": "UniProtKB", "id": "B5A982", "url": "https://www.uniprot.org/uniprot/B5A982" } ], "reference": [ { "type": "PubMed", "id": "18593464", "url": "https://glygen.org/publication/PubMed/18593464" } ] }, { "title": "Cloning, characterisation, and comparative quantitative expression analyses of receptor for advanced glycation end products (RAGE) transcript forms.", "journal": "Gene", "date": "2009", "authors": "Bullerdiek J., Klemke M., Soller J.T., Barann M., Eberle N., Escobar H.M., Nolte I., Sterenczak K.A., Willenbrock S.", "evidence": [ { "database": "UniProtKB", "id": "C0IP14", "url": "https://www.uniprot.org/uniprot/C0IP14" }, { "database": "UniProtKB", "id": "A8MS87", "url": "https://www.uniprot.org/uniprot/A8MS87" } ], "reference": [ { "type": "PubMed", "id": "19061941", "url": "https://glygen.org/publication/PubMed/19061941" } ] }, { "title": "Both Ca2+ and Zn2+ are essential for S100A12 protein oligomerization and function.", "journal": "BMC Biochem.", "date": "2009", "authors": "Xie J., He W., Bjoerk P., Bronstein I.B., Burkitt W., Derrick P.J., Foell D., Ianoul A., Lednev I.K., Moroz O.V., Novitskaya V., Polyakova O., Shekhtman A., Wittkowski H.", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "reference": [ { "type": "PubMed", "id": "19386136", "url": "https://glygen.org/publication/PubMed/19386136" } ] }, { "title": "NEMO-binding domains of both IKKalpha and IKKbeta regulate IkappaB kinase complex assembly and classical NF-kappaB activation.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Solt LA, Madge LA, May MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-933542", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933542" } ], "reference": [ { "type": "PubMed", "id": "19666475", "url": "https://glygen.org/publication/PubMed/19666475" } ] }, { "title": "RAGE-dependent signaling in microglia contributes to neuroinflammation, Abeta accumulation, and impaired learning/memory in a mouse model of Alzheimer's disease.", "journal": "FASEB J.", "date": "2010", "authors": "Fang F., Stern D.M., Xu H., Yan S., Yan S.S., Chen D., Chen J.X., Walker D.G., Lue L.-F., Luddy J.S., Schmidt A.M., Yan S.'", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "reference": [ { "type": "PubMed", "id": "19906677", "url": "https://glygen.org/publication/PubMed/19906677" } ] }, { "title": "The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Boyington J.C., Park H., Adsit F.G.", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "reference": [ { "type": "PubMed", "id": "20943659", "url": "https://glygen.org/publication/PubMed/20943659" } ] }, { "title": "Structural basis for ligand recognition and activation of RAGE.", "journal": "Structure", "date": "2010", "authors": "Fritz G., Koch M., Chazin W.J., Schiefner A., Diez J., Dattilo B.M., Chitayat S.", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "reference": [ { "type": "PubMed", "id": "20947022", "url": "https://glygen.org/publication/PubMed/20947022" } ] }, { "title": "The G82S polymorphism promotes glycosylation of the receptor for advanced glycation end products (RAGE) at asparagine 81: comparison of wild-type rage with the G82S polymorphic variant.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Park SJ, Kleffmann T, Hessian PA", "evidence": [ { "database": "Automatic Literature Mining", "id": "21511948", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/21511948" } ], "reference": [ { "type": "PubMed", "id": "21511948", "url": "https://glygen.org/publication/PubMed/21511948" } ] }, { "title": "S100A14 stimulates cell proliferation and induces cell apoptosis at different concentrations via receptor for advanced glycation end products (RAGE).", "journal": "PLoS ONE", "date": "2011", "authors": "Chen H., Liu Z., Jin Q., Ding F., Luo A.", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "reference": [ { "type": "PubMed", "id": "21559403", "url": "https://glygen.org/publication/PubMed/21559403" } ] }, { "title": "Advanced glycation end product recognition by the receptor for AGEs.", "journal": "Structure", "date": "2011", "authors": "Hoffmann R., Xie J., Rai V., Xue J., Burz D.S., Chabierski S., Reverdatto S., Schmidt A.M., Shekhtman A., Singer D.", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "reference": [ { "type": "PubMed", "id": "21565706", "url": "https://glygen.org/publication/PubMed/21565706" } ] }, { "title": "TIRAP, an adaptor protein for TLR2/4, transduces a signal from RAGE phosphorylated upon ligand binding.", "journal": "PLoS ONE", "date": "2011", "authors": "Sakaguchi M, Murata H, Yamamoto K, Ono T, Sakaguchi Y, Motoyama A, Hibino T, Kataoka K, Huh NH", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" }, { "database": "iPTMnet", "id": "Q15109", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15109" } ], "reference": [ { "type": "PubMed", "id": "21829704", "url": "https://glygen.org/publication/PubMed/21829704" } ] }, { "title": "Disulfide bonds within the C2 domain of RAGE play key roles in its dimerization and biogenesis.", "journal": "PLoS ONE", "date": "2012", "authors": "Wei W, Lampe L, Park S, Vangara BS, Waldo GS, Cabantous S, Subaran SS, Yang D, Lakatta EG, Lin L", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "reference": [ { "type": "PubMed", "id": "23284645", "url": "https://glygen.org/publication/PubMed/23284645" } ] }, { "title": "RAGE is a nucleic acid receptor that promotes inflammatory responses to DNA.", "journal": "J. Exp. Med.", "date": "2013", "authors": "Jiang J., Miller A.L., Tian J., Nakamura H., Chang C., Jin T., Latz E., Xiao T.S., Coyle A.J., Horvath G.L., Sirois C.M., Kolbeck R., Bossaller L., Schrum J., Humbles A.A., Mian A., Bertheloot D., Brewah Y., Chowdhury P.S., Garbi N., Pelka K., Sims G.P.", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "reference": [ { "type": "PubMed", "id": "24081950", "url": "https://glygen.org/publication/PubMed/24081950" } ] }, { "title": "Gly82Ser polymorphism of the receptor for advanced glycation end-product (RAGE) potential high risk in patients with colorectal cancer.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "2014", "authors": "Qian F, Sun BL, Zhang WY, Ke J, Zhu J", "evidence": [ { "database": "Entrez", "id": "177", "url": "https://www.ncbi.nlm.nih.gov/gene/177" } ], "reference": [ { "type": "PubMed", "id": "24248547", "url": "https://glygen.org/publication/PubMed/24248547" } ] }, { "title": "Alternative splicing of the RAGE cytoplasmic domain regulates cell signaling and function.", "journal": "PLoS ONE", "date": "2013", "authors": "Maiguel D., Hudson B.I., Jules J.", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "reference": [ { "type": "PubMed", "id": "24260107", "url": "https://glygen.org/publication/PubMed/24260107" } ] }, { "title": "High Mobility Group Box Protein 1 Boosts Endothelial Albumin Transcytosis through the RAGE/Src/Caveolin-1 Pathway.", "journal": "Sci. Rep.", "date": "2016", "authors": "Shang Dan, Peng Tao, Gou Shanmiao, Li Yiqing, Wu Heshui, Wang Chunyou, Yang Zhiyong", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "reference": [ { "type": "PubMed", "id": "27572515", "url": "https://glygen.org/publication/PubMed/27572515" } ] }, { "title": "Double phosphorylation-induced structural changes in the signal-receiving domain of IkappaBalpha in complex with NF-kappaB.", "journal": "Proteins", "date": "2017", "authors": "Yazdi S, Naumann M, Stein M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "27701768", "url": "https://glygen.org/publication/PubMed/27701768" } ] }, { "title": "Receptor for advanced glycation end products is targeted by FBXO10 for ubiquitination and degradation.", "journal": "FASEB J.", "date": "2017", "authors": "Evankovich John, Lear Travis, Mckelvey Alison, Dunn Sarah, Londino James, Liu Yuan, Chen Bill B, Mallampalli Rama K", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "reference": [ { "type": "PubMed", "id": "28515150", "url": "https://glygen.org/publication/PubMed/28515150" } ] }, { "title": "LPS-induced macrophage HMGB1-loaded extracellular vesicles trigger hepatocyte pyroptosis by activating the NLRP3 inflammasome.", "journal": "Cell. Death. Discov.", "date": "2021", "authors": "Hu Y., Huang W., Li C., Li X., Li Y., Wang J., Huang Y., Wang G., Jin S., Meng Y., Ling X.", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "reference": [ { "type": "PubMed", "id": "34743181", "url": "https://glygen.org/publication/PubMed/34743181" } ] }, { "title": "RAGE inhibition blunts insulin-induced oncogenic signals in breast cancer.", "journal": "Breast cancer research : BCR", "date": "2023-07-17", "authors": "Muoio M G, Pellegrino M, Rapicavoli V, Talia M, Scavo G, Sergi V, Vella V, Pettinato S, Galasso M G, Lappano R, Scordamaglia D, Cirillo F, Pulvirenti A, Rigiracciolo D C, Maggiolini M, Belfiore A, De Francesco E M", "evidence": [ { "database": "RefSeq", "id": "NP_001127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127" } ], "reference": [ { "type": "PubMed", "id": "37461077", "url": "https://glygen.org/publication/PubMed/37461077" } ] }, { "title": "Advanced Glycation End Products' Receptor DNA Methylation Associated with Immune Infiltration and Prognosis of Lung Adenocarcinoma and Lung Squamous Cell Carcinoma.", "journal": "Genetics research", "date": "2023", "authors": "Yang Jun, Lin Mingqiang, Zhang Mengyan, Wang Zhiping, Lin Hancui, Yu Yilin, Zheng Qunhao, Chen Xiaohui, Wu Yahua, Yao Qiwei, Li Jiancheng", "evidence": [ { "database": "RefSeq", "id": "NP_001127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127" } ], "reference": [ { "type": "PubMed", "id": "37497166", "url": "https://glygen.org/publication/PubMed/37497166" } ] }, { "title": "Alpha cell receptor for advanced glycation end products associate with glucagon expression in type 1 diabetes.", "journal": "Scientific reports", "date": "2023-08-09", "authors": "Leung Sherman S, Lenchik Nataliya, Mathews Clayton, Pugliese Alberto, McCarthy Domenica A, Le Bagge Selena, Ewing Adam, Harris Mark, Radford Kristen J, Borg Danielle J, Gerling Ivan, Forbes Josephine M", "evidence": [ { "database": "RefSeq", "id": "NP_001127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127" } ], "reference": [ { "type": "PubMed", "id": "37558746", "url": "https://glygen.org/publication/PubMed/37558746" } ] }, { "title": "Soluble RAGE and skeletal muscle tissue RAGE expression profiles in lean and obese young adults across differential aerobic exercise intensities.", "journal": "Journal of applied physiology (Bethesda, Md. : 1985)", "date": "2023-10-01", "authors": "Miranda Edwin R, Mey Jacob T, Blackburn Brian K, Chaves Alec B, Fuller Kelly N Z, Perkins Ryan K, Ludlow Andrew T, Haus Jacob M", "evidence": [ { "database": "RefSeq", "id": "NP_001127", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001127" } ], "reference": [ { "type": "PubMed", "id": "37675469", "url": "https://glygen.org/publication/PubMed/37675469" } ] }, { "title": "Three genes in the human MHC class III region near the junction with the class II: gene for receptor of advanced glycosylation end products, PBX2 homeobox gene and a notch homolog, human counterpart of mouse mammary tumor gene int-3.", "journal": "Genomics", "date": "1994", "authors": "Takahashi E., Inoko H., Ando A., Matsumoto K., Fukagawa T., Sugaya K., Mita K., Ikemura T.", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "reference": [ { "type": "PubMed", "id": "7835890", "url": "https://glygen.org/publication/PubMed/7835890" } ] }, { "title": "Identification of galectin-3 as a high-affinity binding protein for advanced glycation end products (AGE): a new member of the AGE-receptor complex.", "journal": "Molecular medicine (Cambridge, Mass.)", "date": "1995", "authors": "Vlassara H, Li YM, Imani F, Wojciechowicz D, Yang Z, Liu FT, Cerami A", "evidence": [ { "database": "Reactome", "id": "R-HSA-879415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415" } ], "reference": [ { "type": "PubMed", "id": "8529130", "url": "https://glygen.org/publication/PubMed/8529130" } ] }, { "title": "Activation of the IkappaB alpha kinase complex by MEKK1, a kinase of the JNK pathway.", "journal": "Cell", "date": "1997", "authors": "Lee FS, Hagler J, Chen ZJ, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-933542", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933542" } ], "reference": [ { "type": "PubMed", "id": "9008162", "url": "https://glygen.org/publication/PubMed/9008162" } ] }, { "title": "MEKK1 activates both IkappaB kinase alpha and IkappaB kinase beta.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Lee FS, Peters RT, Dang LC, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-933542", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933542" } ], "reference": [ { "type": "PubMed", "id": "9689078", "url": "https://glygen.org/publication/PubMed/9689078" } ] }, { "title": "Structure of an IkappaBalpha/NF-kappaB complex.", "journal": "Cell", "date": "1998", "authors": "Jacobs MD, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-445989", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989" } ], "reference": [ { "type": "PubMed", "id": "9865693", "url": "https://glygen.org/publication/PubMed/9865693" } ] } ], "pathway": [ { "id": "hsa:177", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:177", "resource": "KEGG Pathway" }, { "id": "R-HSA-445989", "name": "TAK1-dependent IKK and NF-kappa-B activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445989", "resource": "Reactome", "description": "TAK1-dependent IKK and NF-kappa-B activation" }, { "id": "R-HSA-879415", "name": "Advanced glycosylation endproduct receptor signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-879415", "resource": "Reactome", "description": "Advanced glycosylation endproduct receptor signaling" }, { "id": "R-HSA-933542", "name": "TRAF6 mediated NF-kB activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-933542", "resource": "Reactome", "description": "TRAF6 mediated NF-kB activation" } ], "orthologs": [ { "uniprot_canonical_ac": "Q62151-1", "protein_name": "Advanced glycosylation end product-specific receptor", "gene_name": "Ager", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPAGTAARAWVLVLALWGAVAGGQNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLVEPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEVGHEDEGTYSCVATHPSHGPQESPPVSIRVTETGDEGPAEGSVGESGLGTLALALGILGGLGVVALLVGAILWRKRQPRREERKAPESQEDEEERAELNQSEEAEMPENGAGGP", "length": 402 }, "evidence": [ { "id": "45240310", "url": "http://www.informatics.jax.org/homology/45240310", "database": "MGI" }, { "id": "Q15109", "url": "https://omabrowser.org/oma/group/Q15109/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "cell junction", "id": "GO:0030054", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030054", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "fibrillar center", "id": "GO:0001650", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001650", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "postsynapse", "id": "GO:0098794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098794", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 47, "go_terms": [ { "name": "regulation of p38MAPK cascade", "id": "GO:1900744", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900744", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of dendritic cell differentiation", "id": "GO:2001200", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001200", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "negative regulation of interleukin-10 production", "id": "GO:0032693", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032693", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "regulation of T cell mediated cytotoxicity", "id": "GO:0001914", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001914", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "regulation of CD4-positive, alpha-beta T cell activation", "id": "GO:2000514", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000514", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "microglial cell activation", "id": "GO:0001774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001774", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of protein phosphorylation", "id": "GO:0001934", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001934", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "cell surface receptor signaling pathway", "id": "GO:0007166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007166", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "learning or memory", "id": "GO:0007611", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007611", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "neuron projection development", "id": "GO:0031175", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031175", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of JNK cascade", "id": "GO:0046330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046330", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "astrocyte activation", "id": "GO:0048143", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048143", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of NF-kappaB transcription factor activity", "id": "GO:0051092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051092", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "negative regulation of long-term synaptic potentiation", "id": "GO:1900272", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900272", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of NIK/NF-kappaB signaling", "id": "GO:1901224", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901224", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "cellular response to amyloid-beta", "id": "GO:1904646", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904646", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "response to hypoxia", "id": "GO:0001666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001666", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of chemokine production", "id": "GO:0032722", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032722", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of interleukin-6 production", "id": "GO:0032755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032755", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "regulation of synaptic plasticity", "id": "GO:0048167", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048167", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "negative regulation of long-term synaptic depression", "id": "GO:1900453", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900453", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "response to amyloid-beta", "id": "GO:1904645", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904645", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "response to wounding", "id": "GO:0009611", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009611", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "regulation of inflammatory response", "id": "GO:0050727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050727", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of tumor necrosis factor production", "id": "GO:0032760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032760", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "protein localization to membrane", "id": "GO:0072657", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072657", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of p38MAPK cascade", "id": "GO:1900745", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900745", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of monocyte chemotactic protein-1 production", "id": "GO:0071639", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071639", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of interleukin-1 beta production", "id": "GO:0032731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032731", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "regulation of long-term synaptic potentiation", "id": "GO:1900271", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900271", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "transcytosis", "id": "GO:0045056", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045056", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "regulation of NIK/NF-kappaB signaling", "id": "GO:1901222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901222", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "induction of positive chemotaxis", "id": "GO:0050930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050930", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of activated T cell proliferation", "id": "GO:0042104", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042104", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of JUN kinase activity", "id": "GO:0043507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043507", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process", "id": "GO:1902961", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902961", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of heterotypic cell-cell adhesion", "id": "GO:0034116", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034116", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "regulation of DNA binding", "id": "GO:0051101", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051101", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of interleukin-12 production", "id": "GO:0032735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032735", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "glucose mediated signaling pathway", "id": "GO:0010255", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010255", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of monocyte extravasation", "id": "GO:2000439", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000439", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "regulation of spontaneous synaptic transmission", "id": "GO:0150003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0150003", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "negative regulation of blood circulation", "id": "GO:1903523", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903523", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "positive regulation of endothelin production", "id": "GO:1904472", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904472", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "transport across blood-brain barrier", "id": "GO:0150104", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0150104", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 10, "go_terms": [ { "name": "molecular adaptor activity", "id": "GO:0060090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060090", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "advanced glycation end-product receptor activity", "id": "GO:0050785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050785", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "transmembrane signaling receptor activity", "id": "GO:0004888", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004888", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "scavenger receptor activity", "id": "GO:0005044", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005044", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "amyloid-beta binding", "id": "GO:0001540", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001540", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "S100 protein binding", "id": "GO:0044548", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044548", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "laminin receptor activity", "id": "GO:0005055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005055", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" }, { "name": "signaling receptor activity", "id": "GO:0038023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038023", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 25, "end_pos": 27, "annotation": "n_glycosylation_sequon" }, { "start_pos": 389, "end_pos": 391, "annotation": "n_glycosylation_sequon" }, { "start_pos": 81, "end_pos": 83, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated on its cytoplasmic domain by PKCzeta/PRKCZ upon ligand binding.", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" }, { "database": "PubMed", "id": "21829704", "url": "https://glygen.org/publication/PubMed/21829704" } ] }, { "annotation": "Targeted by the ubiquitin E3 ligase subunit FBXO10 to mediate its ubiquitination and degradation.", "evidence": [ { "database": "UniProtKB", "id": "Q15109", "url": "https://www.uniprot.org/uniprot/Q15109" }, { "database": "PubMed", "id": "28515150", "url": "https://glygen.org/publication/PubMed/28515150" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 47 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }