{ "uniprot_canonical_ac": "Q13625-1", "uniprot_ac": "Q13625", "uniprot_id": "ASPP2_HUMAN", "mass": { "chemical_mass": 125616.0, "monoisotopic_mass": 125616.0 }, "refseq": { "ac": "NP_001026855", "name": "apoptosis-stimulating of p53 protein 2 isoform 1", "summary": "This gene encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. It is localized to the perinuclear region of the cytoplasm, and regulates apoptosis and cell growth through interactions with other regulatory molecules including members of the p53 family. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026855" }, "gene_names": [ { "name": "TP53BP2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q13625", "id": "Q13625" }, { "name": "53BP2; ASPP2; BBP; P53BP2; PPP1R13A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026855", "id": "NP_001026855" }, { "name": "ASPP2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q13625", "id": "Q13625" }, { "name": "BBP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q13625", "id": "Q13625" }, { "name": "TP53BP2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026855", "id": "NP_001026855" } ], "protein_names": [ { "name": "Apoptosis-stimulating of p53 protein 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q13625" }, { "name": "53BP2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q13625" }, { "name": "BCL2-binding protein; tumor suppressor p53-binding protein 2; apoptosis-stimulating protein of p53, 2; renal carcinoma antigen NY-REN-51", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026855", "id": "NP_001026855" }, { "name": "Bbp", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q13625" }, { "name": "Bcl2-binding protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q13625" }, { "name": "Renal carcinoma antigen NY-REN-51", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q13625" }, { "name": "Tumor suppressor p53-binding protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q13625" }, { "name": "apoptosis-stimulating of p53 protein 2 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026855", "id": "NP_001026855" }, { "name": "p53-binding protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q13625" }, { "name": "p53BP2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q13625" } ], "function": [ { "annotation": "ASPP2 maintains the integrity of mechanically stressed pseudostratified epithelia during morphogenesis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001026855", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026855" }, { "database": "PubMed", "id": "35177595", "url": "https://glygen.org/publication/PubMed/35177595" } ] }, { "annotation": "Alternative splicing of Apoptosis Stimulating Protein of TP53-2 (ASPP2) results in an oncogenic isoform promoting migration and therapy resistance in soft tissue sarcoma (STS). Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001026855", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026855" }, { "database": "PubMed", "id": "35780096", "url": "https://glygen.org/publication/PubMed/35780096" } ] }, { "annotation": "MRNA sequencing and CyTOF analysis revealed ASPP2 altered the response patterns of hepatocellular carcinoma HepG2 cells to usnic acid.", "evidence": [ { "database": "RefSeq", "id": "NP_001026855", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026855" }, { "database": "PubMed", "id": "36877271", "url": "https://glygen.org/publication/PubMed/36877271" } ] }, { "annotation": "Regulator that plays a central role in regulation of apoptosis and cell growth via its interactions with proteins such as TP53 (PubMed:12524540). Regulates TP53 by enhancing the DNA binding and transactivation function of TP53 on the promoters of proapoptotic genes in vivo. Inhibits the ability of NAE1 to conjugate NEDD8 to CUL1, and thereby decreases NAE1 ability to induce apoptosis. Impedes cell cycle progression at G2/M. Its apoptosis-stimulating activity is inhibited by its interaction with DDX42.", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625#function" }, { "database": "PubMed", "id": "19377511", "url": "https://glygen.org/publication/PubMed/19377511" }, { "database": "PubMed", "id": "12694406", "url": "https://glygen.org/publication/PubMed/12694406" }, { "database": "PubMed", "id": "12524540", "url": "https://glygen.org/publication/PubMed/12524540" }, { "database": "PubMed", "id": "11684014", "url": "https://glygen.org/publication/PubMed/11684014" } ] }, { "annotation": "TP53BP2 encodes two mRNA species, either with (53BP2) or without exon 3 (ASPP2), by alternative splicing in various cell lines and tissues", "evidence": [ { "database": "RefSeq", "id": "NP_001026855", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026855" }, { "database": "PubMed", "id": "14766226", "url": "https://glygen.org/publication/PubMed/14766226" } ] }, { "annotation": "This gene encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. It is localized to the perinuclear region of the cytoplasm, and regulates apoptosis and cell growth through interactions with other regulatory molecules including members of the p53 family. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001026855", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026855" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 1098, "end_pos": 1098, "sequence_org": "W", "sequence_mut": "K", "comment": "Loss of interaction with APC2.", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" }, { "database": "PubMed", "id": "10646860", "url": "https://glygen.org/publication/PubMed/10646860" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "79.35", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000143514", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143514" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "85.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143514", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143514" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "88.49", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143514", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143514" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "77.45", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000143514", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143514" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "86.94", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143514", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143514" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "85.07", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143514", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143514" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "76.86", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000143514", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143514" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "85.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143514", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143514" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "88.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143514", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143514" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "90.06", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143514", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143514" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "88.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143514", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143514" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "81.8", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000143514", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143514" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "84.03", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000143514", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143514" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "Q13625", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13625" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "Q13625", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13625" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "Q13625", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13625" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "Q13625", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13625" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "Q13625", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13625" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "Q13625", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13625" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "Q13625", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13625" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "Q13625", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13625" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "Q13625", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13625" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "Q13625", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13625" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "Q13625", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13625" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "Q13625", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13625" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "common_name": "Human" } ], "gene": [ { "name": "TP53BP2", "url": "https://www.uniprot.org/uniprot/Q13625", "locus": { "chromosome": "1", "start_pos": 223779893, "end_pos": 223845954, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000143514", "url": "https://www.ensembl.org/id/ENSG00000143514" } ] } } ], "crossref": [ { "id": "ENSG00000143514", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000143514", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd11953", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11953", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd17225", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd17225", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "TP53BP2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TP53BP2", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "7159", "url": "https://www.ncbi.nlm.nih.gov/gene/7159", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "12000", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12000", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "Q13625", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13625*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029071", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029071", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036028", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036028", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036770", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036770", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047163", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047163", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047166", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047166", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:7159", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7159", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "602143", "url": "http://www.omim.org/entry/602143", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_Q13625", "url": "https://www.nextprot.org/entry/NX_Q13625", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "Q13625", "url": "https://oglcnac.org/atlas/detail/Q13625", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "Q13625", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q13625", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "MREGDCM", "url": "https://omabrowser.org/oma/group/MREGDCM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5476196at2759", "url": "http://www.orthodb.org/?query=5476196at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24131", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24131", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24131:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24131:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1YCS", "url": "https://www.rcsb.org/structure/1YCS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2UWQ", "url": "https://www.rcsb.org/structure/2UWQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4A63", "url": "https://www.rcsb.org/structure/4A63", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4IRV", "url": "https://www.rcsb.org/structure/4IRV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6GHM", "url": "https://www.rcsb.org/structure/6GHM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6HKP", "url": "https://www.rcsb.org/structure/6HKP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00018", "url": "http://pfam.xfam.org/family/PF00018", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF12796", "url": "http://pfam.xfam.org/family/PF12796", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "Q13625", "url": "https://pharos.nih.gov/targets/Q13625", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_Q13625", "url": "http://purl.obolibrary.org/obo/PR_Q13625", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-139915", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-139915", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001026855", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026855", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "H0Y847", "url": "https://www.uniprot.org/uniprot/H0Y847", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y847-1", "url": "https://www.uniprot.org/uniprot/H0Y847-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C5L8", "url": "https://www.uniprot.org/uniprot/H7C5L8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C5L8-1", "url": "https://www.uniprot.org/uniprot/H7C5L8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q13625-1", "url": "https://www.uniprot.org/uniprot/Q13625-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q13625-2", "url": "https://www.uniprot.org/uniprot/Q13625-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q13625-3", "url": "https://www.uniprot.org/uniprot/Q13625-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMPMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSERPVADNERMFDVLQRFGSQRNEVRFFLRHERPPGRDIVSGPRSQDPSLKRNGVKVPGEYRRKENGVNSPRMDLTLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKLKRLKEIAENQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSKVEELTRQLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAVMDKRVNELRDRLWKKKAALQQKENLPVSSDGNLPQQAASAPSRVAAVGPYIQSSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERIPRPLSPTKLLPFLSNPYRNQSDADLEALRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSYPSKSASVTASSESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDNSPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPEGPGEDSVSMRPPEITGQVSLPPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA", "length": 1128, "header": "sp|Q13625-1|ASPP2_HUMAN Isoform 1 of Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2 CANONICAL=Q13625-1" }, "isoforms": [ { "isoform_ac": "H0Y847-1", "url": "", "sequence": { "sequence": "XSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQYMVSL", "length": 64, "header": "tr|H0Y847-1|H0Y847_HUMAN Computationally mapped isoform of Tumor protein p53 binding protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=1 CANONICAL=Q13625-1" }, "locus": { "chromosome": "1", "start_pos": 223800726, "end_pos": 223796575, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000483398.5", "url": "https://www.ensembl.org/id/ENST00000483398.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000417174.1", "url": "https://www.ensembl.org/id/ENSP00000417174.1" } ] } }, { "isoform_ac": "H7C5L8-1", "url": "", "sequence": { "sequence": "XMFDVLQRFGSQRNEVRFFLRHERPPGRDIVSGPRSQDPSLKRNGVKVPGEYRRKENGVNSPRMDLTLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKLKRLKEIAENQEAKLKKVRALKGHVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDNSPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPEGPGEDSVSMRPPEI", "length": 234, "header": "tr|H7C5L8-1|H7C5L8_HUMAN Computationally mapped isoform of Tumor protein p53 binding protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=1 CANONICAL=Q13625-1" }, "locus": { "chromosome": "1", "start_pos": 223814328, "end_pos": 223795838, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000494100.1", "url": "https://www.ensembl.org/id/ENST00000494100.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000420225.1", "url": "https://www.ensembl.org/id/ENSP00000420225.1" } ] } }, { "isoform_ac": "Q13625-1", "url": "", "sequence": { "sequence": "MMPMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSERPVADNERMFDVLQRFGSQRNEVRFFLRHERPPGRDIVSGPRSQDPSLKRNGVKVPGEYRRKENGVNSPRMDLTLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKLKRLKEIAENQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSKVEELTRQLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAVMDKRVNELRDRLWKKKAALQQKENLPVSSDGNLPQQAASAPSRVAAVGPYIQSSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERIPRPLSPTKLLPFLSNPYRNQSDADLEALRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSYPSKSASVTASSESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDNSPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPEGPGEDSVSMRPPEITGQVSLPPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA", "length": 1128, "header": "sp|Q13625-1|ASPP2_HUMAN Isoform 1 of Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2 CANONICAL=Q13625-1" }, "locus": {} }, { "isoform_ac": "Q13625-2", "url": "", "sequence": { "sequence": "MDLTLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKLKRLKEIAENQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSKVEELTRQLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAVMDKRVNELRDRLWKKKAALQQKENLPVSSDGNLPQQAASAPSRVAAVGPYIQSSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERIPRPLSPTKLLPFLSNPYRNQSDADLEALRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSYPSKSASVTASSESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDNSPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPEGPGEDSVSMRPPEITGQVSLPPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA", "length": 1005, "header": "sp|Q13625-2|ASPP2_HUMAN Isoform 2 of Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2 CANONICAL=Q13625-1" }, "locus": { "chromosome": "1", "start_pos": 223806932, "end_pos": 223780856, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000391878.6", "url": "https://www.ensembl.org/id/ENST00000391878.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000375750.2", "url": "https://www.ensembl.org/id/ENSP00000375750.2" } ] } }, { "isoform_ac": "Q13625-3", "url": "", "sequence": { "sequence": "MRFGSKMMPMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSERPVADNERMFDVLQRFGSQRNEVRFFLRHERPPGRDIVSGPRSQDPSLKRNGVKVPGEYRRKENGVNSPRMDLTLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKLKRLKEIAENQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSKVEELTRQLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAVMDKRVNELRDRLWKKKAALQQKENLPVSSDGNLPQQAASAPSRVAAVGPYIQSSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERIPRPLSPTKLLPFLSNPYRNQSDADLEALRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSYPSKSASVTASSESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDNSPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPEGPGEDSVSMRPPEITGQVSLPPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA", "length": 1134, "header": "sp|Q13625-3|ASPP2_HUMAN Isoform 3 of Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2 CANONICAL=Q13625-1" }, "locus": { "chromosome": "1", "start_pos": 223845680, "end_pos": 223780856, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000343537.12", "url": "https://www.ensembl.org/id/ENST00000343537.12" }, { "database": "Ensembl Peptide", "id": "ENSP00000341957.7", "url": "https://www.ensembl.org/id/ENSP00000341957.7" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 136, "start_aa": "Ser", "end_pos": 136, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser136", "evidence": [ { "id": "Q13625", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q13625" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "Q13625", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q13625" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 328, "start_aa": "Ser", "end_pos": 328, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser328", "evidence": [ { "id": "Q13625", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q13625" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "Q13625", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q13625" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 329, "start_aa": "Ser", "end_pos": 329, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser329", "evidence": [ { "id": "Q13625", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q13625" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "Q13625", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q13625" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 339, "start_aa": "Ser", "end_pos": 339, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser339", "evidence": [ { "id": "Q13625", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q13625" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "Q13625", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q13625" }, { "id": "32938750", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 342, "start_aa": "Ser", "end_pos": 342, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser342", "evidence": [ { "id": "Q13625", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q13625" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 608, "start_aa": "Ser", "end_pos": 608, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser608", "evidence": [ { "id": "Q13625", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q13625" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "30620550", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30620550" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "37340703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37340703" }, { "id": "Q13625", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q13625" } ] } ], "phosphorylation": [ { "start_pos": 414, "end_pos": 414, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q13625", "url": "http://phospho.elm.eu.org/byAccession/Q13625.html" }, { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser414" }, { "start_pos": 480, "end_pos": 480, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "phospho.ELM", "id": "Q13625", "url": "http://phospho.elm.eu.org/byAccession/Q13625.html" }, { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" } ], "site_lbl": "Ser480" }, { "start_pos": 556, "end_pos": 556, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "phospho.ELM", "id": "Q13625", "url": "http://phospho.elm.eu.org/byAccession/Q13625.html" }, { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" } ], "site_lbl": "Ser556" }, { "start_pos": 569, "end_pos": 569, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "phospho.ELM", "id": "Q13625", "url": "http://phospho.elm.eu.org/byAccession/Q13625.html" }, { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser569" }, { "start_pos": 572, "end_pos": 572, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" } ], "site_lbl": "Ser572" }, { "start_pos": 576, "end_pos": 576, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" } ], "site_lbl": "Ser576" }, { "start_pos": 586, "end_pos": 586, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" }, { "database": "PubMed", "id": "22028470", "url": "https://glygen.org/publication/PubMed/22028470" } ], "site_lbl": "Thr586" }, { "start_pos": 698, "end_pos": 698, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" }, { "database": "phospho.ELM", "id": "Q13625", "url": "http://phospho.elm.eu.org/byAccession/Q13625.html" }, { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser698" }, { "start_pos": 714, "end_pos": 714, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" } ], "site_lbl": "Ser714" }, { "start_pos": 736, "end_pos": 736, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q13625", "url": "http://phospho.elm.eu.org/byAccession/Q13625.html" }, { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser736" }, { "start_pos": 737, "end_pos": 737, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "phospho.ELM", "id": "Q13625", "url": "http://phospho.elm.eu.org/byAccession/Q13625.html" }, { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser737" }, { "start_pos": 827, "end_pos": 827, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" }, { "database": "PubMed", "id": "24312625", "url": "https://glygen.org/publication/PubMed/24312625" } ], "site_lbl": "Ser827" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "p53 suppresses the activation of the Bcl-2 promoter by the Brn-3a POU family transcription factor.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Budhram-Mahadeo V, Morris PJ, Smith MD, Midgley CA, Boxer LM, Latchman DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759" } ], "reference": [ { "type": "PubMed", "id": "10329733", "url": "https://glygen.org/publication/PubMed/10329733" } ] }, { "title": "NF-kappaB subunit p65 binds to 53BP2 and inhibits cell death induced by 53BP2.", "journal": "Oncogene", "date": "1999", "authors": "Okamoto T., Takahashi N., Kato H., Yang J.-P., Hori M., Kawabe T.", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "reference": [ { "type": "PubMed", "id": "10498867", "url": "https://glygen.org/publication/PubMed/10498867" } ] }, { "title": "Antigens recognized by autologous antibody in patients with renal-cell carcinoma.", "journal": "Int. J. Cancer", "date": "1999", "authors": "Scanlan MJ, Gordan JD, Williamson B, Stockert E, Bander NH, Jongeneel V, Gure AO, Jager D, Jager E, Knuth A, Chen YT, Old LJ", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "reference": [ { "type": "PubMed", "id": "10508479", "url": "https://glygen.org/publication/PubMed/10508479" } ] }, { "title": "Aberrant overexpression of 53BP2 mRNA in lung cancer cell lines.", "journal": "FEBS Lett.", "date": "2000", "authors": "Okamoto T., Takahashi N., Mori T., Okamoto H., Ueda R.", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "reference": [ { "type": "PubMed", "id": "10631318", "url": "https://glygen.org/publication/PubMed/10631318" } ] }, { "title": "APCL, a central nervous system-specific homologue of adenomatous polyposis coli tumor suppressor, binds to p53-binding protein 2 and translocates it to the perinucleus.", "journal": "Cancer Res.", "date": "2000", "authors": "Nakagawa H, Koyama K, Murata Y, Morito M, Akiyama T, Nakamura Y", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "reference": [ { "type": "PubMed", "id": "10646860", "url": "https://glygen.org/publication/PubMed/10646860" } ] }, { "title": "PERP, an apoptosis-associated target of p53, is a novel member of the PMP-22/gas3 family.", "journal": "Genes & development", "date": "2000", "authors": "Attardi LD, Reczek EE, Cosmas C, Demicco EG, McCurrach ME, Lowe SW, Jacks T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "10733530", "url": "https://glygen.org/publication/PubMed/10733530" } ] }, { "title": "Wild-type p53 transactivates the KILLER/DR5 gene through an intronic sequence-specific DNA-binding site.", "journal": "Oncogene", "date": "2000", "authors": "Takimoto R, El-Deiry WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "10777207", "url": "https://glygen.org/publication/PubMed/10777207" } ] }, { "title": "Noxa, a BH3-only member of the Bcl-2 family and candidate mediator of p53-induced apoptosis.", "journal": "Science (New York, N.Y.)", "date": "2000", "authors": "Oda E, Ohki R, Murasawa H, Nemoto J, Shibue T, Yamashita T, Tokino T, Taniguchi T, Tanaka N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "10807576", "url": "https://glygen.org/publication/PubMed/10807576" } ] }, { "title": "Proapoptotic p53-interacting protein 53BP2 is induced by UV irradiation but suppressed by p53.", "journal": "Mol. Cell. Biol.", "date": "2000", "authors": "Lu X., Naumovski L., O'Connor D.J., Ao Y., Ford J.M., Lopez C.D., Perez T.D., Rohde L.H.", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "reference": [ { "type": "PubMed", "id": "11027272", "url": "https://glygen.org/publication/PubMed/11027272" } ] }, { "title": "p53AIP1, a potential mediator of p53-dependent apoptosis, and its regulation by Ser-46-phosphorylated p53.", "journal": "Cell", "date": "2000", "authors": "Oda K, Arakawa H, Tanaka T, Matsuda K, Tanikawa C, Mori T, Nishimori H, Tamai K, Tokino T, Nakamura Y, Taya Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "11030628", "url": "https://glygen.org/publication/PubMed/11030628" } ] }, { "title": "Bcl-G, a novel pro-apoptotic member of the Bcl-2 family.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Guo B, Godzik A, Reed JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "11054413", "url": "https://glygen.org/publication/PubMed/11054413" } ] }, { "title": "Evidence that the death receptor DR4 is a DNA damage-inducible, p53-regulated gene.", "journal": "Journal of cellular physiology", "date": "2001", "authors": "Guan B, Yue P, Clayman GL, Sun SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "11382926", "url": "https://glygen.org/publication/PubMed/11382926" } ] }, { "title": "PUMA, a novel proapoptotic gene, is induced by p53.", "journal": "Molecular cell", "date": "2001", "authors": "Nakano K, Vousden KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-139915", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-139915" } ], "reference": [ { "type": "PubMed", "id": "11463392", "url": "https://glygen.org/publication/PubMed/11463392" } ] }, { "title": "p53DINP1, a p53-inducible gene, regulates p53-dependent apoptosis.", "journal": "Molecular cell", "date": "2001", "authors": "Okamura S, Arakawa H, Tanaka T, Nakanishi H, Ng CC, Taya Y, Monden M, Nakamura Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "11511362", "url": "https://glygen.org/publication/PubMed/11511362" } ] }, { "title": "Expression of bbc3, a pro-apoptotic BH3-only gene, is regulated by diverse cell death and survival signals.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Han J, Flemington C, Houghton AB, Gu Z, Zambetti GP, Lutz RJ, Zhu L, Chittenden T", "evidence": [ { "database": "Reactome", "id": "R-HSA-139915", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-139915" } ], "reference": [ { "type": "PubMed", "id": "11572983", "url": "https://glygen.org/publication/PubMed/11572983" } ] }, { "title": "Phosphoisoprenoids modulate association of Rab geranylgeranyltransferase with REP-1.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Thoma NH, Iakovenko A, Goody RS, Alexandrov K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "11675392", "url": "https://glygen.org/publication/PubMed/11675392" } ] }, { "title": "ASPP proteins specifically stimulate the apoptotic function of p53.", "journal": "Mol. Cell", "date": "2001", "authors": "Samuels-Lev Y, O'Connor DJ, Bergamaschi D, Trigiante G, Hsieh JK, Zhong S, Campargue I, Naumovski L, Crook T, Lu X", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" }, { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "11684014", "url": "https://glygen.org/publication/PubMed/11684014" } ] }, { "title": "Transcriptional repression of the anti-apoptotic survivin gene by wild type p53.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Hoffman WH, Biade S, Zilfou JT, Chen J, Murphy M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "11714700", "url": "https://glygen.org/publication/PubMed/11714700" } ] }, { "title": "A polymorphic microsatellite that mediates induction of PIG3 by p53.", "journal": "Nature genetics", "date": "2002", "authors": "Contente A, Dittmer A, Koch MC, Roth J, Dobbelstein M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "11919562", "url": "https://glygen.org/publication/PubMed/11919562" } ] }, { "title": "The Brn-3a transcription factor inhibits the pro-apoptotic effect of p53 and enhances cell cycle arrest by differentially regulating the activity of the p53 target genes encoding Bax and p21(CIP1/Waf1).", "journal": "Oncogene", "date": "2002", "authors": "Budram-Mahadeo V, Morris PJ, Latchman DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759" } ], "reference": [ { "type": "PubMed", "id": "12203124", "url": "https://glygen.org/publication/PubMed/12203124" } ] }, { "title": "BID regulation by p53 contributes to chemosensitivity.", "journal": "Nature cell biology", "date": "2002", "authors": "Sax JK, Fei P, Murphy ME, Bernhard E, Korsmeyer SJ, El-Deiry WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "12402042", "url": "https://glygen.org/publication/PubMed/12402042" } ] }, { "title": "Direct interaction with and activation of p53 by SMAR1 retards cell-cycle progression at G2/M phase and delays tumor growth in mice.", "journal": "International journal of cancer", "date": "2003", "authors": "Kaul R, Mukherjee S, Ahmed F, Bhat MK, Chhipa R, Galande S, Chattopadhyay S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759" } ], "reference": [ { "type": "PubMed", "id": "12494467", "url": "https://glygen.org/publication/PubMed/12494467" } ] }, { "title": "iASPP oncoprotein is a key inhibitor of p53 conserved from worm to human.", "journal": "Nat. Genet.", "date": "2003", "authors": "Bergamaschi D, Samuels Y, O'Neil NJ, Trigiante G, Crook T, Hsieh JK, O'Connor DJ, Zhong S, Campargue I, Tomlinson ML, Kuwabara PE, Lu X", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" }, { "database": "Reactome", "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759" } ], "reference": [ { "type": "PubMed", "id": "12524540", "url": "https://glygen.org/publication/PubMed/12524540" } ] }, { "title": "The p53-inducible TSAP6 gene product regulates apoptosis and the cell cycle and interacts with Nix and the Myt1 kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Passer BJ, Nancy-Portebois V, Amzallag N, Prieur S, Cans C, Roborel de Climens A, Fiucci G, Bouvard V, Tuynder M, Susini L, Morchoisne S, Crible V, Lespagnol A, Dausset J, Oren M, Amson R, Telerman A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "12606722", "url": "https://glygen.org/publication/PubMed/12606722" } ] }, { "title": "ASPP2 inhibits APP-BP1-mediated NEDD8 conjugation to cullin-1 and decreases APP-BP1-induced cell proliferation and neuronal apoptosis.", "journal": "J. Neurochem.", "date": "2003", "authors": "Chen Y., Liu W., Neve R.L., Naumovski L.", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "reference": [ { "type": "PubMed", "id": "12694406", "url": "https://glygen.org/publication/PubMed/12694406" } ] }, { "title": "Rab geranylgeranyl transferase. A multisubunit enzyme that prenylates GTP-binding proteins terminating in Cys-X-Cys or Cys-Cys.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Seabra MC, Goldstein JL, Sudhof TC, Brown MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "1321151", "url": "https://glygen.org/publication/PubMed/1321151" } ] }, { "title": "Perp is a mediator of p53-dependent apoptosis in diverse cell types.", "journal": "Current biology : CB", "date": "2003", "authors": "Ihrie RA, Reczek E, Horner JS, Khachatrian L, Sage J, Jacks T, Attardi LD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "14614825", "url": "https://glygen.org/publication/PubMed/14614825" } ] }, { "title": "Tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) decoy receptor TRAIL-R3 is up-regulated by p53 in breast tumor cells through a mechanism involving an intronic p53-binding site.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Ruiz de Almodovar C, Ruiz-Ruiz C, Rodriguez A, Ortiz-Ferron G, Redondo JM, Lopez-Rivas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "14623878", "url": "https://glygen.org/publication/PubMed/14623878" } ] }, { "title": "Up-regulation of Bcl-2 homology 3 (BH3)-only proteins by E2F1 mediates apoptosis.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Hershko T, Ginsberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-139915", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-139915" } ], "reference": [ { "type": "PubMed", "id": "14684737", "url": "https://glygen.org/publication/PubMed/14684737" } ] }, { "title": "ASPP1 and ASPP2: common activators of p53 family members.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Bergamaschi D, Samuels Y, Jin B, Duraisingham S, Crook T, Lu X", "evidence": [ { "database": "Reactome", "id": "R-HSA-139915", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-139915" } ], "reference": [ { "type": "PubMed", "id": "14729977", "url": "https://glygen.org/publication/PubMed/14729977" } ] }, { "title": "Expression of 53BP2 and ASPP2 proteins from TP53BP2 gene by alternative splicing.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Takahashi N, Kobayashi S, Jiang X, Kitagori K, Imai K, Hibi Y, Okamoto T", "evidence": [ { "database": "RefSeq", "id": "NP_001026855", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026855" } ], "reference": [ { "type": "PubMed", "id": "14766226", "url": "https://glygen.org/publication/PubMed/14766226" } ] }, { "title": "Apoptotic signaling pathways induced by nitric oxide in human lymphoblastoid cells expressing wild-type or mutant p53.", "journal": "Cancer research", "date": "2004", "authors": "Li CQ, Robles AI, Hanigan CL, Hofseth LJ, Trudel LJ, Harris CC, Wogan GN", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "15126337", "url": "https://glygen.org/publication/PubMed/15126337" } ] }, { "title": "Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.", "journal": "Anal. Chem.", "date": "2004", "authors": "Brill LM, Salomon AR, Ficarro SB, Mukherji M, Stettler-Gill M, Peters EC", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "reference": [ { "type": "PubMed", "id": "15144186", "url": "https://glygen.org/publication/PubMed/15144186" } ] }, { "title": "AMID is a p53-inducible gene downregulated in tumors.", "journal": "Oncogene", "date": "2004", "authors": "Wu M, Xu LG, Su T, Tian Y, Zhai Z, Shu HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "15273740", "url": "https://glygen.org/publication/PubMed/15273740" } ] }, { "title": "p53 upregulates death receptor 4 expression through an intronic p53 binding site.", "journal": "Cancer research", "date": "2004", "authors": "Liu X, Yue P, Khuri FR, Sun SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "15289308", "url": "https://glygen.org/publication/PubMed/15289308" } ] }, { "title": "NDRG1 is necessary for p53-dependent apoptosis.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Stein S, Thomas EK, Herzog B, Westfall MD, Rocheleau JV, Jackson RS 2nd, Wang M, Liang P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "15377670", "url": "https://glygen.org/publication/PubMed/15377670" } ] }, { "title": "The BCL6 proto-oncogene suppresses p53 expression in germinal-centre B cells.", "journal": "Nature", "date": "2004", "authors": "Phan RT, Dalla-Favera R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "15577913", "url": "https://glygen.org/publication/PubMed/15577913" } ] }, { "title": "Brn-3a transcription factor blocks p53-mediated activation of proapoptotic target genes Noxa and Bax in vitro and in vivo to determine cell fate.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Hudson CD, Morris PJ, Latchman DS, Budhram-Mahadeo VS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759" } ], "reference": [ { "type": "PubMed", "id": "15598651", "url": "https://glygen.org/publication/PubMed/15598651" } ] }, { "title": "Bnip3L is induced by p53 under hypoxia, and its knockdown promotes tumor growth.", "journal": "Cancer cell", "date": "2004", "authors": "Fei P, Wang W, Kim SH, Wang S, Burns TF, Sax JK, Buzzai M, Dicker DT, McKenna WG, Bernhard EJ, El-Deiry WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "15607964", "url": "https://glygen.org/publication/PubMed/15607964" } ] }, { "title": "Tumor suppressor SMAR1 activates and stabilizes p53 through its arginine-serine-rich motif.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Jalota A, Singh K, Pavithra L, Kaul-Ghanekar R, Jameel S, Chattopadhyay S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759" } ], "reference": [ { "type": "PubMed", "id": "15701641", "url": "https://glygen.org/publication/PubMed/15701641" } ] }, { "title": "p53CSV, a novel p53-inducible gene involved in the p53-dependent cell-survival pathway.", "journal": "Cancer research", "date": "2005", "authors": "Park WR, Nakamura Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "15735003", "url": "https://glygen.org/publication/PubMed/15735003" } ] }, { "title": "p53-Dependent and p53-independent induction of insulin-like growth factor binding protein-3 by deoxyribonucleic acid damage and hypoxia.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2005", "authors": "Grimberg A, Coleman CM, Burns TF, Himelstein BP, Koch CJ, Cohen P, El-Deiry WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "15769996", "url": "https://glygen.org/publication/PubMed/15769996" } ] }, { "title": "Perp is a p63-regulated gene essential for epithelial integrity.", "journal": "Cell", "date": "2005", "authors": "Ihrie RA, Marques MR, Nguyen BT, Horner JS, Papazoglu C, Bronson RT, Mills AA, Attardi LD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "15797384", "url": "https://glygen.org/publication/PubMed/15797384" } ] }, { "title": "Chemical genetics identifies Rab geranylgeranyl transferase as an apoptotic target of farnesyl transferase inhibitors.", "journal": "Cancer cell", "date": "2005", "authors": "Lackner MR, Kindt RM, Carroll PM, Brown K, Cancilla MR, Chen C, de Silva H, Franke Y, Guan B, Heuer T, Hung T, Keegan K, Lee JM, Manne V, O'Brien C, Parry D, Perez-Villar JJ, Reddy RK, Xiao H, Zhan H, Cockett M, Plowman G, Fitzgerald K, Costa M, Ross-Macdonald P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "15837622", "url": "https://glygen.org/publication/PubMed/15837622" } ] }, { "title": "A genomic map of p53 binding sites identifies novel p53 targets involved in an apoptotic network.", "journal": "Cancer research", "date": "2005", "authors": "Miled C, Pontoglio M, Garbay S, Yaniv M, Weitzman JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "15958553", "url": "https://glygen.org/publication/PubMed/15958553" } ] }, { "title": "Identification of novel p53 target genes in ionizing radiation response.", "journal": "Cancer research", "date": "2005", "authors": "Jen KY, Cheung VG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "16140933", "url": "https://glygen.org/publication/PubMed/16140933" } ] }, { "title": "Decoy receptor 2 (DcR2) is a p53 target gene and regulates chemosensitivity.", "journal": "Cancer research", "date": "2005", "authors": "Liu X, Yue P, Khuri FR, Sun SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "16230375", "url": "https://glygen.org/publication/PubMed/16230375" } ] }, { "title": "BCL6 is regulated by p53 through a response element frequently disrupted in B-cell non-Hodgkin lymphoma.", "journal": "Blood", "date": "2006", "authors": "Margalit O, Amram H, Amariglio N, Simon AJ, Shaklai S, Granot G, Minsky N, Shimoni A, Harmelin A, Givol D, Shohat M, Oren M, Rechavi G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "16249378", "url": "https://glygen.org/publication/PubMed/16249378" } ] }, { "title": "Hzf, a p53-responsive gene, regulates maintenance of the G2 phase checkpoint induced by DNA damage.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Sugimoto M, Gromley A, Sherr CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759" } ], "reference": [ { "type": "PubMed", "id": "16382142", "url": "https://glygen.org/publication/PubMed/16382142" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Brn-3b enhances the pro-apoptotic effects of p53 but not its induction of cell cycle arrest by cooperating in trans-activation of bax expression.", "journal": "Nucleic acids research", "date": "2006", "authors": "Budhram-Mahadeo VS, Bowen S, Lee S, Perez-Sanchez C, Ensor E, Morris PJ, Latchman DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759" } ], "reference": [ { "type": "PubMed", "id": "17145718", "url": "https://glygen.org/publication/PubMed/17145718" } ] }, { "title": "DYRK2 is targeted to the nucleus and controls p53 via Ser46 phosphorylation in the apoptotic response to DNA damage.", "journal": "Molecular cell", "date": "2007", "authors": "Taira N, Nihira K, Yamaguchi T, Miki Y, Yoshida K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "17349958", "url": "https://glygen.org/publication/PubMed/17349958" } ] }, { "title": "p53-dependent NDRG1 expression induces inhibition of intestinal epithelial cell proliferation but not apoptosis after polyamine depletion.", "journal": "American journal of physiology. Cell physiology", "date": "2007", "authors": "Zhang AH, Rao JN, Zou T, Liu L, Marasa BS, Xiao L, Chen J, Turner DJ, Wang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "17442733", "url": "https://glygen.org/publication/PubMed/17442733" } ] }, { "title": "Solution structure of ASPP2 N-terminal domain (N-ASPP2) reveals a ubiquitin-like fold.", "journal": "J. Mol. Biol.", "date": "2007", "authors": "Rutherford T.J., Andreeva A., Fersht A.R., Tidow H.", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "reference": [ { "type": "PubMed", "id": "17594908", "url": "https://glygen.org/publication/PubMed/17594908" } ] }, { "title": "Hzf Determines cell survival upon genotoxic stress by modulating p53 transactivation.", "journal": "Cell", "date": "2007", "authors": "Das S, Raj L, Zhao B, Kimura Y, Bernstein A, Aaronson SA, Lee SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759" } ], "reference": [ { "type": "PubMed", "id": "17719541", "url": "https://glygen.org/publication/PubMed/17719541" } ] }, { "title": "Biochemical and structural studies of ASPP proteins reveal differential binding to p53, p63, and p73.", "journal": "Structure (London, England : 1993)", "date": "2008", "authors": "Robinson RA, Lu X, Jones EY, Siebold C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759" } ], "reference": [ { "type": "PubMed", "id": "18275817", "url": "https://glygen.org/publication/PubMed/18275817" } ] }, { "title": "Rab geranylgeranylation occurs preferentially via the pre-formed REP-RGGT complex and is regulated by geranylgeranyl pyrophosphate.", "journal": "The Biochemical journal", "date": "2008", "authors": "Baron RA, Seabra MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "18532927", "url": "https://glygen.org/publication/PubMed/18532927" } ] }, { "title": "Exosome secretion, including the DNA damage-induced p53-dependent secretory pathway, is severely compromised in TSAP6/Steap3-null mice.", "journal": "Cell death and differentiation", "date": "2008", "authors": "Lespagnol A, Duflaut D, Beekman C, Blanc L, Fiucci G, Marine JC, Vidal M, Amson R, Telerman A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "18617898", "url": "https://glygen.org/publication/PubMed/18617898" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" }, { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Molecular interactions of ASPP1 and ASPP2 with the p53 protein family and the apoptotic promoters PUMA and Bax.", "journal": "Nucleic acids research", "date": "2008", "authors": "Patel S, George R, Autore F, Fraternali F, Ladbury JE, Nikolova PV", "evidence": [ { "database": "Reactome", "id": "R-HSA-139915", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-139915" } ], "reference": [ { "type": "PubMed", "id": "18676979", "url": "https://glygen.org/publication/PubMed/18676979" } ] }, { "title": "P53 apoptosis mediator PERP: localization, function and caspase activation in uveal melanoma.", "journal": "Journal of cellular and molecular medicine", "date": "2009", "authors": "Davies L, Gray D, Spiller D, White MR, Damato B, Grierson I, Paraoan L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "19040420", "url": "https://glygen.org/publication/PubMed/19040420" } ] }, { "title": "SMAR1 forms a ternary complex with p53-MDM2 and negatively regulates p53-mediated transcription.", "journal": "Journal of molecular biology", "date": "2009", "authors": "Pavithra L, Mukherjee S, Sreenath K, Kar S, Sakaguchi K, Roy S, Chattopadhyay S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759" } ], "reference": [ { "type": "PubMed", "id": "19303885", "url": "https://glygen.org/publication/PubMed/19303885" } ] }, { "title": "Three-dimensional structure and enzymatic function of proapoptotic human p53-inducible quinone oxidoreductase PIG3.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Porte S, Valencia E, Yakovtseva EA, Borras E, Shafqat N, Debreczeny JE, Pike AC, Oppermann U, Farres J, Fita I, Pares X", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "19349281", "url": "https://glygen.org/publication/PubMed/19349281" } ] }, { "title": "KRAB-type zinc-finger protein Apak specifically regulates p53-dependent apoptosis.", "journal": "Nature cell biology", "date": "2009", "authors": "Tian C, Xing G, Xie P, Lu K, Nie J, Wang J, Li L, Gao M, Zhang L, He F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "19377469", "url": "https://glygen.org/publication/PubMed/19377469" } ] }, { "title": "The DEAD box protein Ddx42p modulates the function of ASPP2, a stimulator of apoptosis.", "journal": "Oncogene", "date": "2009", "authors": "Uhlmann-Schiffler H, Kiermayer S, Stahl H", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "reference": [ { "type": "PubMed", "id": "19377511", "url": "https://glygen.org/publication/PubMed/19377511" } ] }, { "title": "BCL6 suppression of BCL2 via Miz1 and its disruption in diffuse large B cell lymphoma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Saito M, Novak U, Piovan E, Basso K, Sumazin P, Schneider C, Crespo M, Shen Q, Bhagat G, Califano A, Chadburn A, Pasqualucci L, Dalla-Favera R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "19549844", "url": "https://glygen.org/publication/PubMed/19549844" } ] }, { "title": "Active transcription of the human FAS/CD95/TNFRSF6 gene involves the p53 family.", "journal": "Biochemical and biophysical research communications", "date": "2009", "authors": "Schilling T, Schleithoff ES, Kairat A, Melino G, Stremmel W, Oren M, Krammer PH, Muller M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "19615968", "url": "https://glygen.org/publication/PubMed/19615968" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" }, { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" }, { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Coordinated regulation of p53 apoptotic targets BAX and PUMA by SMAR1 through an identical MAR element.", "journal": "The EMBO journal", "date": "2010", "authors": "Sinha S, Malonia SK, Mittal SP, Singh K, Kadreppa S, Kamat R, Mukhopadhyaya R, Pal JK, Chattopadhyay S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759" } ], "reference": [ { "type": "PubMed", "id": "20075864", "url": "https://glygen.org/publication/PubMed/20075864" } ] }, { "title": "Identification of a novel cell death receptor mediating IGFBP-3-induced anti-tumor effects in breast and prostate cancer.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Ingermann AR, Yang YF, Han J, Mikami A, Garza AE, Mohanraj L, Fan L, Idowu M, Ware JL, Kim HS, Lee DY, Oh Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "20353938", "url": "https://glygen.org/publication/PubMed/20353938" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" }, { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Large-scale discovery of ERK2 substrates identifies ERK-mediated transcriptional regulation by ETV3.", "journal": "Science signaling", "date": "2011", "authors": "Carlson SM, Chouinard CR, Labadorf A, Lam CJ, Schmelzle K, Fraenkel E, White FM", "evidence": [ { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" } ], "reference": [ { "type": "PubMed", "id": "22028470", "url": "https://glygen.org/publication/PubMed/22028470" } ] }, { "title": "Apak competes with p53 for direct binding to intron 1 of p53AIP1 to regulate apoptosis.", "journal": "EMBO reports", "date": "2012", "authors": "Yuan L, Tian C, Wang H, Song S, Li D, Xing G, Yin Y, He F, Zhang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "22334068", "url": "https://glygen.org/publication/PubMed/22334068" } ] }, { "title": "Identification of Akt interaction protein PHF20/TZP that transcriptionally regulates p53.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Park S, Kim D, Dan HC, Chen H, Testa JR, Cheng JQ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759" } ], "reference": [ { "type": "PubMed", "id": "22334668", "url": "https://glygen.org/publication/PubMed/22334668" } ] }, { "title": "iASPP inhibits p53-independent apoptosis by inhibiting transcriptional activity of p63/p73 on promoters of proapoptotic genes.", "journal": "Apoptosis : an international journal on programmed cell death", "date": "2012", "authors": "Cai Y, Qiu S, Gao X, Gu SZ, Liu ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759" } ], "reference": [ { "type": "PubMed", "id": "22538442", "url": "https://glygen.org/publication/PubMed/22538442" } ] }, { "title": "iASPPsv antagonizes apoptosis induced by chemotherapeutic agents in MCF-7 cells and mouse thymocytes.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Wang L, Xing H, Tian Z, Peng L, Li Y, Tang K, Rao Q, Wang M, Wang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "22766503", "url": "https://glygen.org/publication/PubMed/22766503" } ] }, { "title": "PHF20 is an effector protein of p53 double lysine methylation that stabilizes and activates p53.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Cui G, Park S, Badeaux AI, Kim D, Lee J, Thompson JR, Yan F, Kaneko S, Yuan Z, Botuyan MV, Bedford MT, Cheng JQ, Mer G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759" } ], "reference": [ { "type": "PubMed", "id": "22864287", "url": "https://glygen.org/publication/PubMed/22864287" } ] }, { "title": "PKB-mediated PHF20 phosphorylation on Ser291 is required for p53 function in DNA damage.", "journal": "Cellular signalling", "date": "2013", "authors": "Li Y, Park J, Piao L, Kong G, Kim Y, Park KA, Zhang T, Hong J, Hur GM, Seok JH, Choi SW, Yoo BC, Hemmings BA, Brazil DP, Kim SH, Park J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759" } ], "reference": [ { "type": "PubMed", "id": "22975685", "url": "https://glygen.org/publication/PubMed/22975685" } ] }, { "title": "Bcl-2 family member Bcl-G is not a proapoptotic protein.", "journal": "Cell death & disease", "date": "2012", "authors": "Giam M, Okamoto T, Mintern JD, Strasser A, Bouillet P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "23059823", "url": "https://glygen.org/publication/PubMed/23059823" } ] }, { "title": "A novel ER-localized transmembrane protein, EMC6, interacts with RAB5A and regulates cell autophagy.", "journal": "Autophagy", "date": "2013", "authors": "Li Y, Zhao Y, Hu J, Xiao J, Qu L, Wang Z, Ma D, Chen Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "23182941", "url": "https://glygen.org/publication/PubMed/23182941" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" }, { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "ASPP1/2 regulate p53-dependent death of retinal ganglion cells through PUMA and Fas/CD95 activation in vivo.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2013", "authors": "Wilson AM, Morquette B, Abdouh M, Unsain N, Barker PA, Feinstein E, Bernier G, Di Polo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-139915", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-139915" } ], "reference": [ { "type": "PubMed", "id": "23365256", "url": "https://glygen.org/publication/PubMed/23365256" } ] }, { "title": "Metastasis suppressor, NDRG1, mediates its activity through signaling pathways and molecular motors.", "journal": "Carcinogenesis", "date": "2013", "authors": "Sun J, Zhang D, Bae DH, Sahni S, Jansson P, Zheng Y, Zhao Q, Yue F, Zheng M, Kovacevic Z, Richardson DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "23671130", "url": "https://glygen.org/publication/PubMed/23671130" } ] }, { "title": "A genetic screen identifies TCF3/E2A and TRIAP1 as pathway-specific regulators of the cellular response to p53 activation.", "journal": "Cell reports", "date": "2013", "authors": "Andrysik Z, Kim J, Tan AC, Espinosa JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "23684607", "url": "https://glygen.org/publication/PubMed/23684607" } ] }, { "title": "TRIAP1/PRELI complexes prevent apoptosis by mediating intramitochondrial transport of phosphatidic acid.", "journal": "Cell metabolism", "date": "2013", "authors": "Potting C, Tatsuta T, Konig T, Haag M, Wai T, Aaltonen MJ, Langer T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "23931759", "url": "https://glygen.org/publication/PubMed/23931759" } ] }, { "title": "N-myc downstream-regulated gene 1: Diverse and complicated functions in human hepatocellular carcinoma (Review).", "journal": "Oncology letters", "date": "2013", "authors": "Song Y, Cao L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "24260043", "url": "https://glygen.org/publication/PubMed/24260043" } ] }, { "title": "Phosphorylation of ASPP2 by RAS/MAPK pathway is critical for its full pro-apoptotic function.", "journal": "PloS one", "date": "2013", "authors": "Godin-Heymann N, Wang Y, Slee E, Lu X", "evidence": [ { "database": "iPTMnet", "id": "Q13625", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13625" } ], "reference": [ { "type": "PubMed", "id": "24312625", "url": "https://glygen.org/publication/PubMed/24312625" } ] }, { "title": "Inhibitor of apoptosis-stimulating protein of p53 (iASPP) is required for neuronal survival after axonal injury.", "journal": "PloS one", "date": "2014", "authors": "Wilson AM, Chiodo VA, Boye SL, Brecha NC, Hauswirth WW, Di Polo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759" } ], "reference": [ { "type": "PubMed", "id": "24714389", "url": "https://glygen.org/publication/PubMed/24714389" } ] }, { "title": "Intramitochondrial recruitment of endolysosomes mediates Smac degradation and constitutes a novel intrinsic apoptosis antagonizing function of XIAP E3 ligase.", "journal": "Cell death and differentiation", "date": "2014", "authors": "Hamacher-Brady A, Choe SC, Krijnse-Locker J, Brady NR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "25080938", "url": "https://glygen.org/publication/PubMed/25080938" } ] }, { "title": "Co-expression of POU4F2/Brn-3b with p53 may be important for controlling expression of pro-apoptotic genes in cardiomyocytes following ischaemic/hypoxic insults.", "journal": "Cell death & disease", "date": "2014", "authors": "Budhram-Mahadeo V, Fujita R, Bitsi S, Sicard P, Heads R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804759", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759" } ], "reference": [ { "type": "PubMed", "id": "25356872", "url": "https://glygen.org/publication/PubMed/25356872" } ] }, { "title": "Identifying tandem Ankyrin repeats in protein structures.", "journal": "BMC Bioinformatics", "date": "2014", "authors": "Chakrabarty B., Parekh N.", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "reference": [ { "type": "PubMed", "id": "25547411", "url": "https://glygen.org/publication/PubMed/25547411" } ] }, { "title": "Structural insight into the TRIAP1/PRELI-like domain family of mitochondrial phospholipid transfer complexes.", "journal": "EMBO reports", "date": "2015", "authors": "Miliara X, Garnett JA, Tatsuta T, Abid Ali F, Baldie H, Perez-Dorado I, Simpson P, Yague E, Langer T, Matthews S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "26071602", "url": "https://glygen.org/publication/PubMed/26071602" } ] }, { "title": "Involvement of p53 in insulin-like growth factor binding protein-3 regulation in the breast cancer cell response to DNA damage.", "journal": "Oncotarget", "date": "2015", "authors": "Marzec KA, Lin MZ, Martin JL, Baxter RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "26378048", "url": "https://glygen.org/publication/PubMed/26378048" } ] }, { "title": "Quantitative Profiling of Protein O-GlcNAcylation Sites by an Isotope-Tagged Cleavable Linker.", "journal": "ACS chemical biology", "date": "2018", "authors": "Qin K, Zhu Y, Qin W, Gao J, Shao X, Wang YL, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q13625", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q13625" }, { "database": "O-GlcNAc Atlas", "id": "Q13625", "url": "https://oglcnac.org/atlas/detail/Q13625" } ], "reference": [ { "type": "PubMed", "id": "30059200", "url": "https://glygen.org/publication/PubMed/30059200" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q13625", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q13625" }, { "database": "O-GlcNAc Atlas", "id": "Q13625", "url": "https://oglcnac.org/atlas/detail/Q13625" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "An Isotope-Coded Photocleavable Probe for Quantitative Profiling of Protein O-GlcNAcylation.", "journal": "ACS chemical biology", "date": "2019", "authors": "Li J, Li Z, Duan X, Qin K, Dang L, Sun S, Cai L, Hsieh-Wilson LC, Wu L, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q13625", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q13625" }, { "database": "O-GlcNAc Atlas", "id": "Q13625", "url": "https://oglcnac.org/atlas/detail/Q13625" } ], "reference": [ { "type": "PubMed", "id": "30620550", "url": "https://glygen.org/publication/PubMed/30620550" } ] }, { "title": "Next-generation unnatural monosaccharides reveal that ESRRB O-GlcNAcylation regulates pluripotency of mouse embryonic stem cells.", "journal": "Nature communications", "date": "2019", "authors": "Hao Y, Fan X, Shi Y, Zhang C, Sun DE, Qin K, Qin W, Zhou W, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q13625", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q13625" }, { "database": "O-GlcNAc Atlas", "id": "Q13625", "url": "https://oglcnac.org/atlas/detail/Q13625" } ], "reference": [ { "type": "PubMed", "id": "31492838", "url": "https://glygen.org/publication/PubMed/31492838" } ] }, { "title": "Methods for Enrichment and Assignment of N-Acetylglucosamine Modification Sites.", "journal": "Molecular & cellular proteomics : MCP", "date": "2021", "authors": "Maynard JC, Chalkley RJ", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "Q13625", "url": "https://oglcnac.org/atlas/detail/Q13625" } ], "reference": [ { "type": "PubMed", "id": "32938750", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q13625", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q13625" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Simultaneously Identifying and Distinguishing Glycoproteins with O-GlcNAc and O-GalNAc (the Tn Antigen) in Human Cancer Cells.", "journal": "Analytical chemistry", "date": "2022", "authors": "Xu S, Zheng J, Xiao H, Wu R", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q13625", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q13625" } ], "reference": [ { "type": "PubMed", "id": "35132862", "url": "https://glygen.org/publication/PubMed/35132862" } ] }, { "title": "ASPP2 maintains the integrity of mechanically stressed pseudostratified epithelia during morphogenesis.", "journal": "Nature communications", "date": "2022", "authors": "Royer C, Sandham E, Slee E, Schneider F, Lagerholm CB, Godwin J, Veits N, Hathrell H, Zhou F, Leonavicius K, Garratt J, Narendra T, Vincent A, Jones C, Child T, Coward K, Graham C, Fritzsche M, Lu X, Srinivas S", "evidence": [ { "database": "RefSeq", "id": "NP_001026855", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026855" } ], "reference": [ { "type": "PubMed", "id": "35177595", "url": "https://glygen.org/publication/PubMed/35177595" } ] }, { "title": "An Optimized Isotopic Photocleavable Tagging Strategy for Site-Specific and Quantitative Profiling of Protein O-GlcNAcylation in Colorectal Cancer Metastasis.", "journal": "ACS chemical biology", "date": "2022", "authors": "Liu J, Hao Y, Wang C, Jin Y, Yang Y, Gu J, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q13625", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q13625" } ], "reference": [ { "type": "PubMed", "id": "35254053", "url": "https://glygen.org/publication/PubMed/35254053" } ] }, { "title": "Alternative splicing of Apoptosis Stimulating Protein of TP53-2 (ASPP2) results in an oncogenic isoform promoting migration and therapy resistance in soft tissue sarcoma (STS).", "journal": "BMC cancer", "date": "2022", "authors": "Tsintari V, Walter B, Fend F, Overkamp M, Rothermundt C, Lopez CD, Schittenhelm MM, Kampa-Schittenhelm KM", "evidence": [ { "database": "RefSeq", "id": "NP_001026855", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026855" } ], "reference": [ { "type": "PubMed", "id": "35780096", "url": "https://glygen.org/publication/PubMed/35780096" } ] }, { "title": "mRNA sequencing and CyTOF analysis revealed ASPP2 altered the response patterns of hepatocellular carcinoma HepG2 cells to usnic acid.", "journal": "Naunyn-Schmiedeberg's archives of pharmacology", "date": "2023-08", "authors": "Wang Yang, Yan Yadong, Huo Yunfei, Pang Yuheng, Chan Liujia, Wang Shanshan, Chen Dexi, Lin Dongdong, Wang Wenjing", "evidence": [ { "database": "RefSeq", "id": "NP_001026855", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001026855" } ], "reference": [ { "type": "PubMed", "id": "36877271", "url": "https://glygen.org/publication/PubMed/36877271" } ] }, { "title": "`Two Birds One Stone` Strategy for the Site-Specific Analysis of Core Fucosylation and O-GlcNAcylation.", "journal": "Journal of the American Chemical Society", "date": "2023-07-26", "authors": "Luo Yawen, Wang Yuqiu, Tian Yinping, Zhou Hu, Wen Liuqing", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q13625", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q13625" } ], "reference": [ { "type": "PubMed", "id": "37340703", "url": "https://glygen.org/publication/PubMed/37340703" } ] }, { "title": "Induction of the growth inhibitor IGF-binding protein 3 by p53.", "journal": "Nature", "date": "1995", "authors": "Buckbinder L, Talbott R, Velasco-Miguel S, Takenaka I, Faha B, Seizinger BR, Kley N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "7566179", "url": "https://glygen.org/publication/PubMed/7566179" } ] }, { "title": "Tumor suppressor p53 is a direct transcriptional activator of the human bax gene.", "journal": "Cell", "date": "1995", "authors": "Miyashita T, Reed JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803204", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204" } ], "reference": [ { "type": "PubMed", "id": "7834749", "url": "https://glygen.org/publication/PubMed/7834749" } ] }, { "title": "Rab geranylgeranyl transferase catalyzes the geranylgeranylation of adjacent cysteines in the small GTPases Rab1A, Rab3A, and Rab5A.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Farnsworth CC, Seabra MC, Ericsson LH, Gelb MH, Glomset JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803205", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205" } ], "reference": [ { "type": "PubMed", "id": "7991565", "url": "https://glygen.org/publication/PubMed/7991565" } ] }, { "title": "Two cellular proteins that bind to wild-type but not mutant p53.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1994", "authors": "Li B., Iwabuchi K., Bartel P.L., Fields S., Marraccino R.", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "reference": [ { "type": "PubMed", "id": "8016121", "url": "https://glygen.org/publication/PubMed/8016121" } ] }, { "title": "The p53-binding protein 53BP2 also interacts with Bcl2 and impedes cell cycle progression at G2/M.", "journal": "Mol. Cell. Biol.", "date": "1996", "authors": "Naumovski L, Cleary ML", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "reference": [ { "type": "PubMed", "id": "8668206", "url": "https://glygen.org/publication/PubMed/8668206" } ] }, { "title": "Structure of the p53 tumor suppressor bound to the ankyrin and SH3 domains of 53BP2.", "journal": "Science", "date": "1996", "authors": "Gorina S., Pavletich N.P.", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "reference": [ { "type": "PubMed", "id": "8875926", "url": "https://glygen.org/publication/PubMed/8875926" } ] }, { "title": "KILLER/DR5 is a DNA damage-inducible p53-regulated death receptor gene.", "journal": "Nature genetics", "date": "1997", "authors": "Wu GS, Burns TF, McDonald ER 3rd, Jiang W, Meng R, Krantz ID, Kao G, Gan DD, Zhou JY, Muschel R, Hamilton SR, Spinner NB, Markowitz S, Wu G, el-Deiry WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211" } ], "reference": [ { "type": "PubMed", "id": "9326928", "url": "https://glygen.org/publication/PubMed/9326928" } ] } ], "pathway": [ { "id": "hsa:7159", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7159", "resource": "KEGG Pathway" }, { "id": "R-HSA-139915", "name": "Activation of PUMA and translocation to mitochondria", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-139915", "resource": "Reactome", "description": "Activation of PUMA and translocation to mitochondria" }, { "id": "R-HSA-6803204", "name": "TP53 Regulates Transcription of Genes Involved in Cytochrome C Release", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803204", "resource": "Reactome", "description": "TP53 Regulates Transcription of Genes Involved in Cytochrome C Release" }, { "id": "R-HSA-6803205", "name": "TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803205", "resource": "Reactome", "description": "TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain" }, { "id": "R-HSA-6803211", "name": "TP53 Regulates Transcription of Death Receptors and Ligands", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803211", "resource": "Reactome", "description": "TP53 Regulates Transcription of Death Receptors and Ligands" }, { "id": "R-HSA-6804759", "name": "Regulation of TP53 Activity through Association with Co-factors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804759", "resource": "Reactome", "description": "Regulation of TP53 Activity through Association with Co-factors" } ], "orthologs": [ { "uniprot_canonical_ac": "F1M5H6-1", "protein_name": "Tumor protein p53 binding protein, 2", "gene_name": "Tp53bp2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRFGSKMMPMFLTVYLSNSEQHFTEVPVTPETVCRDVVDLCKEPGESDCHLAEVWCGSERPVADNERMFDVLQRFGSQRNEVRFFLRHERPPNRDIVSGPRSQDAGVKRNGVKVPGEHRRKENGVNSPRLDLTLAELQEMASRQQQQIEAQQQMLATKEQRLKFLKQQDQRQQQQAAEQEKLKRLREIAESQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNSLFQQKQRELVLAVSKVEELTRQLEMLKNGRIDGHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAVMDKRVNELRDRLWKKKAALQQKENLPVSPDGNPPQQAVSAPSRVAAVGPYMQSSTMPRMPSRPELLGKPALPDSSLVMQSAEGPMKIQTLPNMRSGAASQSKGPKAHSASSDWNPSSTDLLPSQGSGSALDQVDEGEIALREKEKKVRPFSMFDTVDQCAPPPSFGTLRKNQSSEDILRDAQTVNKNVAKVPPPVPTKPKQINLPYFGQTAQSSSDVKPDGNPQQLPIAATSMGAKLKPAGPQARVLLSPSAPSGGQDQVLSPASKQESPPAAAVRPFTPQPSKDTFPPAFRKPQTVAASSIYSMYTQHQVPGKNFQQAVQSASTKTHPRGPHFSSVYGKPVIAAAQNPQQHPENIYSCSQGKPGSPEPETEPVSSVHESHENERIPRPLSPTKLLPFLSNPYRNQSDADLEALRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSYPSKSPSSVTVNPESPIEIPNPYLHVEPEKEAGSLVPEPLSPEDMGSASTENSDMPAPPPGLECVSEGVPDNSTTLQDNTEGTNPEAPHLLEVYLEEYPPYPPPPYPSGEPEVSEEDSARMRPPEVTGQVSLPPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYQPQHDDELLLKEGDCMAVVRREDEDETEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA", "length": 1128 }, "evidence": [ { "id": "45228941", "url": "http://www.informatics.jax.org/homology/45228941", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8CG79-1", "protein_name": "Apoptosis-stimulating of p53 protein 2", "gene_name": "Tp53bp2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MMPMFLTVYLSNSEQHFTEVPVTPETICRDVVDLCKEPGENDCHLAEVWCGSERPVADNERMFDVLQRFGSQRNEVRFFLRHERPPNRDIVSGPRSQDPSVKRNGVKVPGEHRRKENGVNSPRLDLTLAELQEMASRQQQQIEAQQQMLATKEQRLKFLKQQDQRQQQQAAEQEKLKRLREIAESQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNSLFQQKQRELVLAVSKVEELTRQLEMLKNGRIDGHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAVMDKRVSELRDRLWKKKAALQQKENLPVSPDGNLPQQAVSAPSRVAAVGPYIQSSTMPRMPSRPELLVKPALPDGSLLMQSAEGPMKIQTLPNMRSGAASQSKGSKAHPASPDWNPSNADLLPSQGSSVPQSAGTALDQVDDGEIAVREKEKKVRPFSMFDTVDQCAAPPSFGTLRKNQSSEDILRDAQAVNKNVAKVPPPVPTKPKQIHLPYFGQTAQSPSDMKPDGNAQQLPIAATSVGAKLKPAGPQARMLLSPGAPSGGQDQVLSPASKQESPPAAAVRPFTPQPSKDTFPPAFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTQPRGPHFSSVYGKPVIAAAQNPQQHPENIYSCSQGKPGSPEPETETVSSVHESHENERIPRPLSPTKLLPFLSNPYRNQSDADLEALRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSHPSKSPGSVTVNPESSVEIPNPYLHVEPEKEVGSLVPEPLSPEDMGSASTENSDVPAPSAGLEYVSEGVTDSSTNLQNNVEETNPEAPHLLEVYLEEYPPYPPPPYPSGEPEVSEEDSARMRPPEITGQVSLPPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQHDDELLMKEGDCMTVIRREDEEEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA", "length": 1128 }, "evidence": [ { "id": "45228941", "url": "http://www.informatics.jax.org/homology/45228941", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "pmid": "" }, { "name": "cell junction", "id": "GO:0030054", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030054", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "pmid": "" }, { "name": "positive regulation of neuron death", "id": "GO:1901216", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901216", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "pmid": "" }, { "name": "cell cycle", "id": "GO:0007049", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007049", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "pmid": "" }, { "name": "intrinsic apoptotic signaling pathway by p53 class mediator", "id": "GO:0072332", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072332", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "pmid": "" }, { "name": "negative regulation of cell cycle", "id": "GO:0045786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045786", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "pmid": "" }, { "name": "positive regulation of execution phase of apoptosis", "id": "GO:1900119", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900119", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "pmid": "" }, { "name": "regulation of apoptotic process", "id": "GO:0042981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042981", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "SH3 domain binding", "id": "GO:0017124", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017124", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "pmid": "" }, { "name": "NF-kappaB binding", "id": "GO:0051059", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051059", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "pmid": "" }, { "name": "p53 binding", "id": "GO:0002039", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002039", "evidence": [ { "database": "UniProtKB", "id": "Q13625", "url": "https://www.uniprot.org/uniprot/Q13625" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 256, "end_pos": 258, "annotation": "n_glycosylation_sequon" }, { "start_pos": 478, "end_pos": 480, "annotation": "n_glycosylation_sequon" }, { "start_pos": 712, "end_pos": 714, "annotation": "n_glycosylation_sequon" }, { "start_pos": 815, "end_pos": 817, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 12 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 113 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }