{ "uniprot_canonical_ac": "Q13042-1", "uniprot_ac": "Q13042", "uniprot_id": "CDC16_HUMAN", "mass": { "chemical_mass": 71656.0, "monoisotopic_mass": 71656.0 }, "refseq": { "ac": "NP_001072113", "name": "cell division cycle protein 16 homolog isoform 1", "summary": "The protein encoded by this gene functions as a protein ubiquitin ligase and is a component of the multiprotein APC complex. The APC complex is a cyclin degradation system that governs exit from mitosis by targeting cell cycle proteins for degredation by the 26S proteasome. Each component protein of the APC complex is highly conserved among eukaryotic organisms. This protein, and other APC complex proteins, contain a tetratricopeptide repeat (TPR) domain; a protein domain that is often involved in protein-protein interactions and the assembly of multiprotein complexes. Multiple alternatively spliced transcript variants, encoding distinct proteins, have been identified. [provided by RefSeq, Jan 2016].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001072113" }, "gene_names": [ { "name": "CDC16", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q13042", "id": "Q13042" }, { "name": "ANAPC6; APC6; CDC16Hs; CUT9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_011533155", "id": "XP_011533155" }, { "name": "ANAPC6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q13042", "id": "Q13042" }, { "name": "CDC16", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_011533155", "id": "XP_011533155" } ], "protein_names": [ { "name": "Cell division cycle protein 16 homolog", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q13042" }, { "name": "APC6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q13042" }, { "name": "Anaphase-promoting complex subunit 6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q13042" }, { "name": "CDC16 homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q13042" }, { "name": "CDC16Hs", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q13042" }, { "name": "Cyclosome subunit 6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q13042" }, { "name": "cell division cycle protein 16 homolog isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001072113", "id": "NP_001072113" }, { "name": "cell division cycle protein 16 homolog isoform X2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_011533155", "id": "XP_011533155" }, { "name": "cell division cycle protein 16 homolog; cell division cycle 16 homolog; anaphase-promoting complex, subunit 6; cyclosome subunit 6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001072113", "id": "NP_001072113" } ], "function": [ { "annotation": "Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042#function" }, { "database": "PubMed", "id": "18485873", "url": "https://glygen.org/publication/PubMed/18485873" } ] }, { "annotation": "DEPDC1B Promotes Melanoma Angiogenesis and Metastasis through Sequestration of Ubiquitin Ligase CDC16 to Stabilize Secreted SCUBE3.", "evidence": [ { "database": "RefSeq", "id": "NP_001072113", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001072113" }, { "database": "PubMed", "id": "35088579", "url": "https://glygen.org/publication/PubMed/35088579" } ] }, { "annotation": "The protein encoded by this gene functions as a protein ubiquitin ligase and is a component of the multiprotein APC complex. The APC complex is a cyclin degradation system that governs exit from mitosis by targeting cell cycle proteins for degredation by the 26S proteasome. Each component protein of the APC complex is highly conserved among eukaryotic organisms. This protein, and other APC complex proteins, contain a tetratricopeptide repeat (TPR) domain; a protein domain that is often involved in protein-protein interactions and the assembly of multiprotein complexes. Multiple alternatively spliced transcript variants, encoding distinct proteins, have been identified. [provided by RefSeq, Jan 2016].", "evidence": [ { "database": "RefSeq", "id": "NP_001072113", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001072113" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "Q13042", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q13042" } ], "glycoeffect": [], "start_pos": 521, "end_pos": 521, "subjects_tested": "92", "subjects_positive": "1", "frequency": "1.1", "sequence_org": "H", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.1%).", "chr_id": "13", "chr_pos": "114265198", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "H521", "keywords": [ "biomuta", "somatic", "cancer" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "93.91", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000130177", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130177" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "92.48", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000130177", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130177" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "93.87", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000130177", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130177" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "95.02", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000130177", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130177" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "96.18", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000130177", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130177" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "96.85", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000130177", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130177" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "92.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000130177", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130177" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "95.5", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000130177", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130177" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "95.8", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000130177", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130177" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "89.26", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000130177", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130177" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "95.15", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000130177", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130177" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "96.38", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000130177", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130177" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "96.68", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000130177", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130177" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "Q13042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13042" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "Q13042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13042" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "Q13042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13042" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "Q13042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13042" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "Q13042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13042" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "Q13042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13042" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "Q13042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13042" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "Q13042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13042" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "Q13042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13042" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "Q13042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13042" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "Q13042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13042" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "Q13042", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q13042" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "common_name": "Human" } ], "gene": [ { "name": "CDC16", "url": "https://www.uniprot.org/uniprot/Q13042", "locus": { "chromosome": "13", "start_pos": 114272723, "end_pos": 114234887, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000130177", "url": "https://www.ensembl.org/id/ENSG00000130177" } ] } } ], "crossref": [ { "id": "ENSG00000130177", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000130177", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "Q13042", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/Q13042", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "CDC16", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CDC16", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "8881", "url": "https://www.ncbi.nlm.nih.gov/gene/8881", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1720", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=1720", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "Q13042", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13042*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR011990", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011990", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019734", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019734", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8881", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8881", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603461", "url": "http://www.omim.org/entry/603461", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_Q13042", "url": "https://www.nextprot.org/entry/NX_Q13042", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "DPFHNNA", "url": "https://omabrowser.org/oma/group/DPFHNNA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1215698at2759", "url": "http://www.orthodb.org/?query=1215698at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12558", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12558", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12558:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12558:SF9", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3HYM", "url": "https://www.rcsb.org/structure/3HYM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4UI9", "url": "https://www.rcsb.org/structure/4UI9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5A31", "url": "https://www.rcsb.org/structure/5A31", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5G04", "url": "https://www.rcsb.org/structure/5G04", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5G05", "url": "https://www.rcsb.org/structure/5G05", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5KHR", "url": "https://www.rcsb.org/structure/5KHR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5KHU", "url": "https://www.rcsb.org/structure/5KHU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5L9T", "url": "https://www.rcsb.org/structure/5L9T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5L9U", "url": "https://www.rcsb.org/structure/5L9U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LCW", "url": "https://www.rcsb.org/structure/5LCW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6Q6G", "url": "https://www.rcsb.org/structure/6Q6G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6Q6H", "url": "https://www.rcsb.org/structure/6Q6H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TLJ", "url": "https://www.rcsb.org/structure/6TLJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TM5", "url": "https://www.rcsb.org/structure/6TM5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TNT", "url": "https://www.rcsb.org/structure/6TNT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QE7", "url": "https://www.rcsb.org/structure/7QE7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF12895", "url": "http://pfam.xfam.org/family/PF12895", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13424", "url": "http://pfam.xfam.org/family/PF13424", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "Q13042", "url": "https://pharos.nih.gov/targets/Q13042", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_Q13042", "url": "http://purl.obolibrary.org/obo/PR_Q13042", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-141430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141430", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-174048", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174048", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-174084", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174084", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-174154", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174154", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-174184", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174184", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-176407", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176407", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-176408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176408", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-176409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176409", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-176412", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176412", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-179409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-179409", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69017", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8853884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9687136", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9687136", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001072113", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001072113", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A3B3ISD2", "url": "https://www.uniprot.org/uniprot/A0A3B3ISD2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B3ISD2-1", "url": "https://www.uniprot.org/uniprot/A0A3B3ISD2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q13042-1", "url": "https://www.uniprot.org/uniprot/Q13042-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q13042-2", "url": "https://www.uniprot.org/uniprot/Q13042-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q13042-3", "url": "https://www.uniprot.org/uniprot/Q13042-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q13042-4", "url": "https://www.uniprot.org/uniprot/Q13042-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T8C6", "url": "https://www.uniprot.org/uniprot/Q5T8C6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T8C6-1", "url": "https://www.uniprot.org/uniprot/Q5T8C6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST", "length": 620, "header": "sp|Q13042-1|CDC16_HUMAN Isoform 1 of Cell division cycle protein 16 homolog OS=Homo sapiens OX=9606 GN=CDC16 PE=1 SV=2 CANONICAL=Q13042-1" }, "isoforms": [ { "isoform_ac": "A0A3B3ISD2-1", "url": "", "sequence": { "sequence": "MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIAPNWK", "length": 539, "header": "tr|A0A3B3ISD2-1|CDC16_HUMAN Computationally mapped isoform of Cell division cycle protein 16 homolog OS=Homo sapiens OX=9606 GN=CDC16 PE=1 SV=1 CANONICAL=Q13042-1" }, "locus": { "chromosome": "13", "start_pos": 114269576, "end_pos": 114235085, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000650489.1", "url": "https://www.ensembl.org/id/ENST00000650489.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000497168.1", "url": "https://www.ensembl.org/id/ENSP00000497168.1" } ] } }, { "isoform_ac": "Q13042-1", "url": "", "sequence": { "sequence": "MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST", "length": 620, "header": "sp|Q13042-1|CDC16_HUMAN Isoform 1 of Cell division cycle protein 16 homolog OS=Homo sapiens OX=9606 GN=CDC16 PE=1 SV=2 CANONICAL=Q13042-1" }, "locus": { "chromosome": "13", "start_pos": 114272440, "end_pos": 114235085, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000356221.8", "url": "https://www.ensembl.org/id/ENST00000356221.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000348554.3", "url": "https://www.ensembl.org/id/ENSP00000348554.3" } ] } }, { "isoform_ac": "Q13042-2", "url": "", "sequence": { "sequence": "MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST", "length": 619, "header": "sp|Q13042-2|CDC16_HUMAN Isoform 2 of Cell division cycle protein 16 homolog OS=Homo sapiens OX=9606 GN=CDC16 PE=1 SV=2 CANONICAL=Q13042-1" }, "locus": { "chromosome": "13", "start_pos": 114272440, "end_pos": 114235085, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000252457.9", "url": "https://www.ensembl.org/id/ENST00000252457.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000252457.5", "url": "https://www.ensembl.org/id/ENSP00000252457.5" } ] } }, { "isoform_ac": "Q13042-3", "url": "", "sequence": { "sequence": "MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST", "length": 568, "header": "sp|Q13042-3|CDC16_HUMAN Isoform 3 of Cell division cycle protein 16 homolog OS=Homo sapiens OX=9606 GN=CDC16 PE=1 SV=2 CANONICAL=Q13042-1" }, "locus": {} }, { "isoform_ac": "Q13042-4", "url": "", "sequence": { "sequence": "MEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST", "length": 526, "header": "sp|Q13042-4|CDC16_HUMAN Isoform 4 of Cell division cycle protein 16 homolog OS=Homo sapiens OX=9606 GN=CDC16 PE=1 SV=2 CANONICAL=Q13042-1" }, "locus": { "chromosome": "13", "start_pos": 114272440, "end_pos": 114239392, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000375310.5", "url": "https://www.ensembl.org/id/ENST00000375310.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000364459.1", "url": "https://www.ensembl.org/id/ENSP00000364459.1" } ] } }, { "isoform_ac": "Q5T8C6-1", "url": "", "sequence": { "sequence": "MEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST", "length": 475, "header": "tr|Q5T8C6-1|CDC16_HUMAN Computationally mapped isoform of Cell division cycle protein 16 homolog OS=Homo sapiens OX=9606 GN=CDC16 PE=1 SV=1 CANONICAL=Q13042-1" }, "locus": { "chromosome": "13", "start_pos": 114272440, "end_pos": 114239392, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000252458.6", "url": "https://www.ensembl.org/id/ENST00000252458.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000252458.6", "url": "https://www.ensembl.org/id/ENSP00000252458.6" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 112, "end_pos": 112, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" }, { "database": "PubMed", "id": "14657031", "url": "https://glygen.org/publication/PubMed/14657031" }, { "database": "phospho.ELM", "id": "Q13042", "url": "http://phospho.elm.eu.org/byAccession/Q13042.html" }, { "database": "iPTMnet", "id": "Q13042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042" }, { "database": "PubMed", "id": "22067460", "url": "https://glygen.org/publication/PubMed/22067460" } ], "site_lbl": "Ser112" }, { "start_pos": 490, "end_pos": 490, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" }, { "database": "PubMed", "id": "14657031", "url": "https://glygen.org/publication/PubMed/14657031" }, { "database": "phospho.ELM", "id": "Q13042", "url": "http://phospho.elm.eu.org/byAccession/Q13042.html" }, { "database": "iPTMnet", "id": "Q13042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042" } ], "site_lbl": "Ser490" }, { "start_pos": 560, "end_pos": 560, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042" }, { "database": "PubMed", "id": "14657031", "url": "https://glygen.org/publication/PubMed/14657031" } ], "site_lbl": "Ser560" }, { "start_pos": 560, "end_pos": 560, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" }, { "database": "PubMed", "id": "14657031", "url": "https://glygen.org/publication/PubMed/14657031" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q13042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "phospho.ELM", "id": "Q13042", "url": "http://phospho.elm.eu.org/byAccession/Q13042.html" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "PubMed", "id": "22067460", "url": "https://glygen.org/publication/PubMed/22067460" } ], "site_lbl": "Ser560" }, { "start_pos": 581, "end_pos": 581, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" }, { "database": "PubMed", "id": "14657031", "url": "https://glygen.org/publication/PubMed/14657031" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "Q13042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "phospho.ELM", "id": "Q13042", "url": "http://phospho.elm.eu.org/byAccession/Q13042.html" }, { "database": "PubMed", "id": "22067460", "url": "https://glygen.org/publication/PubMed/22067460" } ], "site_lbl": "Thr581" }, { "start_pos": 589, "end_pos": 589, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q13042", "url": "http://phospho.elm.eu.org/byAccession/Q13042.html" }, { "database": "iPTMnet", "id": "Q13042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042" }, { "database": "PubMed", "id": "22067460", "url": "https://glygen.org/publication/PubMed/22067460" } ], "site_lbl": "Thr589" }, { "start_pos": 595, "end_pos": 595, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" }, { "database": "PubMed", "id": "14657031", "url": "https://glygen.org/publication/PubMed/14657031" }, { "database": "phospho.ELM", "id": "Q13042", "url": "http://phospho.elm.eu.org/byAccession/Q13042.html" }, { "database": "iPTMnet", "id": "Q13042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042" } ], "site_lbl": "Ser595" }, { "start_pos": 599, "end_pos": 599, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" }, { "database": "PubMed", "id": "14657031", "url": "https://glygen.org/publication/PubMed/14657031" }, { "database": "phospho.ELM", "id": "Q13042", "url": "http://phospho.elm.eu.org/byAccession/Q13042.html" }, { "database": "iPTMnet", "id": "Q13042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042" } ], "site_lbl": "Thr599" }, { "start_pos": 607, "end_pos": 607, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q13042", "url": "http://phospho.elm.eu.org/byAccession/Q13042.html" }, { "database": "iPTMnet", "id": "Q13042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042" }, { "database": "PubMed", "id": "22067460", "url": "https://glygen.org/publication/PubMed/22067460" } ], "site_lbl": "Ser607" }, { "start_pos": 614, "end_pos": 614, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q13042", "url": "http://phospho.elm.eu.org/byAccession/Q13042.html" }, { "database": "iPTMnet", "id": "Q13042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042" }, { "database": "PubMed", "id": "22067460", "url": "https://glygen.org/publication/PubMed/22067460" } ], "site_lbl": "Ser614" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Beta-catenin regulates expression of cyclin D1 in colon carcinoma cells.", "journal": "Nature", "date": "1999", "authors": "Tetsu O, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8853884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884" } ], "reference": [ { "type": "PubMed", "id": "10201372", "url": "https://glygen.org/publication/PubMed/10201372" } ] }, { "title": "The cyclin D1 gene is a target of the beta-catenin/LEF-1 pathway.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Shtutman M, Zhurinsky J, Simcha I, Albanese C, D'Amico M, Pestell R, Ben-Ze'ev A", "evidence": [ { "database": "Reactome", "id": "R-HSA-8853884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884" } ], "reference": [ { "type": "PubMed", "id": "10318916", "url": "https://glygen.org/publication/PubMed/10318916" } ] }, { "title": "Multistep regulation of DNA replication by Cdk phosphorylation of HsCdc6.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Jiang W, Wells NJ, Hunter T", "evidence": [ { "database": "Reactome", "id": "R-HSA-69017", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017" } ], "reference": [ { "type": "PubMed", "id": "10339564", "url": "https://glygen.org/publication/PubMed/10339564" } ] }, { "title": "Identification of a vertebrate sister-chromatid separation inhibitor involved in transformation and tumorigenesis.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Zou H, McGarry TJ, Bernal T, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "10411507", "url": "https://glygen.org/publication/PubMed/10411507" } ] }, { "title": "Serotonin-inducible transcription of interleukin-1alpha in uterine smooth muscle cells requires an AP-1 site: cloning and partial characterization of the rat IL-1alpha promoter.", "journal": "Molecular and cellular endocrinology", "date": "1999", "authors": "Huang TT, Vinci JM, Lan L, Jeffrey JJ, Wilcox BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "10432220", "url": "https://glygen.org/publication/PubMed/10432220" } ] }, { "title": "Accumulation of cyclin B1 requires E2F and cyclin-A-dependent rearrangement of the anaphase-promoting complex.", "journal": "Nature", "date": "1999", "authors": "Lukas C, Sorensen CS, Kramer E, Santoni-Rugiu E, Lindeneg C, Peters JM, Bartek J, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "10548110", "url": "https://glygen.org/publication/PubMed/10548110" } ] }, { "title": "Human p55(CDC)/Cdc20 associates with cyclin A and is phosphorylated by the cyclin A-Cdk2 complex.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Ohtoshi A, Maeda T, Higashi H, Ashizawa S, Hatakeyama M", "evidence": [ { "database": "Reactome", "id": "R-HSA-174184", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174184" } ], "reference": [ { "type": "PubMed", "id": "10679238", "url": "https://glygen.org/publication/PubMed/10679238" } ] }, { "title": "The KEN box: an APC recognition signal distinct from the D box targeted by Cdh1.", "journal": "Genes & development", "date": "2000", "authors": "Pfleger CM, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178" } ], "reference": [ { "type": "PubMed", "id": "10733526", "url": "https://glygen.org/publication/PubMed/10733526" } ] }, { "title": "Mitotic regulation of the APC activator proteins CDC20 and CDH1.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Kramer ER, Scheuringer N, Podtelejnikov AV, Mann M, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-176407", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176407" } ], "reference": [ { "type": "PubMed", "id": "10793135", "url": "https://glygen.org/publication/PubMed/10793135" } ] }, { "title": "Electron microscopic observation and single-stranded DNA binding activity of the Mcm4,6,7 complex.", "journal": "Journal of molecular biology", "date": "2000", "authors": "Sato M, Gotow T, You Z, Komamura-Kohno Y, Uchiyama Y, Yabuta N, Nojima H, Ishimi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "10884341", "url": "https://glygen.org/publication/PubMed/10884341" } ] }, { "title": "Cell cycle- and cell growth-regulated proteolysis of mammalian CDC6 is dependent on APC-CDH1.", "journal": "Genes & development", "date": "2000", "authors": "Petersen BO, Wagener C, Marinoni F, Kramer ER, Melixetian M, Lazzerini Denchi E, Gieffers C, Matteucci C, Peters JM, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-69017", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017" } ], "reference": [ { "type": "PubMed", "id": "10995389", "url": "https://glygen.org/publication/PubMed/10995389" } ] }, { "title": "Chromatin association of human origin recognition complex, cdc6, and minichromosome maintenance proteins during the cell cycle: assembly of prereplication complexes in late mitosis.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Mendez J, Stillman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-69017", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017" } ], "reference": [ { "type": "PubMed", "id": "11046155", "url": "https://glygen.org/publication/PubMed/11046155" } ] }, { "title": "Two new proteases in the MHC class I processing pathway.", "journal": "Nature immunology", "date": "2000", "authors": "Stoltze L, Schirle M, Schwarz G, Schroter C, Thompson MW, Hersh LB, Kalbacher H, Stevanovic S, Rammensee HG, Schild H", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "11062501", "url": "https://glygen.org/publication/PubMed/11062501" } ] }, { "title": "Two distinct pathways remove mammalian cohesin from chromosome arms in prophase and from centromeres in anaphase.", "journal": "Cell", "date": "2000", "authors": "Waizenegger IC, Hauf S, Meinke A, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "11081627", "url": "https://glygen.org/publication/PubMed/11081627" } ] }, { "title": "Interleukin-6-induced tethering of STAT3 to the LAP/C/EBPbeta promoter suggests a new mechanism of transcriptional regulation by STAT3.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Niehof M, Streetz K, Rakemann T, Bischoff SC, Manns MP, Horn F, Trautwein C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "11114305", "url": "https://glygen.org/publication/PubMed/11114305" } ] }, { "title": "Inhibition of eukaryotic DNA replication by geminin binding to Cdt1.", "journal": "Science (New York, N.Y.)", "date": "2000", "authors": "Wohlschlegel JA, Dwyer BT, Dhar SK, Cvetic C, Walter JC, Dutta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "11125146", "url": "https://glygen.org/publication/PubMed/11125146" } ] }, { "title": "Identification of two residues in MCM5 critical for the assembly of MCM complexes and Stat1-mediated transcription activation in response to IFN-gamma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "DaFonseca CJ, Shu F, Zhang JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "11248027", "url": "https://glygen.org/publication/PubMed/11248027" } ] }, { "title": "Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Geley S, Kramer E, Gieffers C, Gannon J, Peters JM, Hunt T", "evidence": [ { "database": "Reactome", "id": "R-HSA-174184", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174184" } ], "reference": [ { "type": "PubMed", "id": "11285280", "url": "https://glygen.org/publication/PubMed/11285280" } ] }, { "title": "A conserved cyclin-binding domain determines functional interplay between anaphase-promoting complex-Cdh1 and cyclin A-Cdk2 during cell cycle progression.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Sorensen CS, Lukas C, Kramer ER, Peters JM, Bartek J, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "11340163", "url": "https://glygen.org/publication/PubMed/11340163" } ] }, { "title": "26S proteasomes and immunoproteasomes produce mainly N-extended versions of an antigenic peptide.", "journal": "The EMBO journal", "date": "2001", "authors": "Cascio P, Hilton C, Kisselev AF, Rock KL, Goldberg AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "11350924", "url": "https://glygen.org/publication/PubMed/11350924" } ] }, { "title": "Securin is required for chromosomal stability in human cells.", "journal": "Cell", "date": "2001", "authors": "Jallepalli PV, Waizenegger IC, Bunz F, Langer S, Speicher MR, Peters JM, Kinzler KW, Vogelstein B, Lengauer C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "11371342", "url": "https://glygen.org/publication/PubMed/11371342" } ] }, { "title": "Cohesin cleavage by separase required for anaphase and cytokinesis in human cells.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Hauf S, Waizenegger IC, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "11509732", "url": "https://glygen.org/publication/PubMed/11509732" } ] }, { "title": "Checkpoint inhibition of the APC/C in HeLa cells is mediated by a complex of BUBR1, BUB3, CDC20, and MAD2.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Sudakin V, Chan GK, Yen TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-141430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141430" } ], "reference": [ { "type": "PubMed", "id": "11535616", "url": "https://glygen.org/publication/PubMed/11535616" } ] }, { "title": "Substrate recognition by the Cdc20 and Cdh1 components of the anaphase-promoting complex.", "journal": "Genes & development", "date": "2001", "authors": "Pfleger CM, Lee E, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "11562349", "url": "https://glygen.org/publication/PubMed/11562349" } ] }, { "title": "Regulation of the anaphase-promoting complex by the dual specificity phosphatase human Cdc14a.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Bembenek J, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-176407", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176407" } ], "reference": [ { "type": "PubMed", "id": "11598127", "url": "https://glygen.org/publication/PubMed/11598127" } ] }, { "title": "APC/C-mediated destruction of the centrosomal kinase Nek2A occurs in early mitosis and depends upon a cyclin A-type D-box.", "journal": "The EMBO journal", "date": "2001", "authors": "Hames RS, Wattam SL, Yamano H, Bacchieri R, Fry AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-179409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-179409" } ], "reference": [ { "type": "PubMed", "id": "11742988", "url": "https://glygen.org/publication/PubMed/11742988" } ] }, { "title": "The cyclin-ubiquitin ligase activity of cyclosome/APC is jointly activated by protein kinases Cdk1-cyclin B and Plk.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Golan A, Yudkovsky Y, Hershko A", "evidence": [ { "database": "Reactome", "id": "R-HSA-176412", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176412" } ], "reference": [ { "type": "PubMed", "id": "11859075", "url": "https://glygen.org/publication/PubMed/11859075" } ] }, { "title": "E2F-dependent accumulation of hEmi1 regulates S phase entry by inhibiting APC(Cdh1).", "journal": "Nature cell biology", "date": "2002", "authors": "Hsu JY, Reimann JD, Sorensen CS, Lukas J, Jackson PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-176408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176408" } ], "reference": [ { "type": "PubMed", "id": "11988738", "url": "https://glygen.org/publication/PubMed/11988738" } ] }, { "title": "Crystal structure of the tetrameric Mad1-Mad2 core complex: implications of a 'safety belt' binding mechanism for the spindle checkpoint.", "journal": "The EMBO journal", "date": "2002", "authors": "Sironi L, Mapelli M, Knapp S, De Antoni A, Jeang KT, Musacchio A", "evidence": [ { "database": "Reactome", "id": "R-HSA-141430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141430" } ], "reference": [ { "type": "PubMed", "id": "12006501", "url": "https://glygen.org/publication/PubMed/12006501" } ] }, { "title": "Human securin proteolysis is controlled by the spindle checkpoint and reveals when the APC/C switches from activation by Cdc20 to Cdh1.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Hagting A, Den Elzen N, Vodermaier HC, Waizenegger IC, Peters JM, Pines J", "evidence": [ { "database": "Reactome", "id": "R-HSA-174154", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174154" } ], "reference": [ { "type": "PubMed", "id": "12070128", "url": "https://glygen.org/publication/PubMed/12070128" } ] }, { "title": "Regulation of human separase by securin binding and autocleavage.", "journal": "Current biology : CB", "date": "2002", "authors": "Waizenegger I, Gimenez-Abian JF, Wernic D, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "12194817", "url": "https://glygen.org/publication/PubMed/12194817" } ] }, { "title": "The D-Box-activating domain (DAD) is a new proteolysis signal that stimulates the silent D-Box sequence of Aurora-A.", "journal": "EMBO reports", "date": "2002", "authors": "Castro A, Vigneron S, Bernis C, Labbe JC, Prigent C, Lorca T", "evidence": [ { "database": "Reactome", "id": "R-HSA-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178" } ], "reference": [ { "type": "PubMed", "id": "12446569", "url": "https://glygen.org/publication/PubMed/12446569" } ] }, { "title": "U-box proteins as a new family of ubiquitin ligases.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Hatakeyama S, Nakayama KI", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "12646216", "url": "https://glygen.org/publication/PubMed/12646216" } ] }, { "title": "Phosphorylation of p90 ribosomal S6 kinase (RSK) regulates extracellular signal-regulated kinase docking and RSK activity.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Roux PP, Richards SA, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "12832467", "url": "https://glygen.org/publication/PubMed/12832467" } ] }, { "title": "Mitotic regulation of the human anaphase-promoting complex by phosphorylation.", "journal": "The EMBO journal", "date": "2003", "authors": "Kraft C, Herzog F, Gieffers C, Mechtler K, Hagting A, Pines J, Peters JM", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" }, { "database": "Reactome", "id": "R-HSA-176412", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176412" }, { "database": "iPTMnet", "id": "Q13042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042" } ], "reference": [ { "type": "PubMed", "id": "14657031", "url": "https://glygen.org/publication/PubMed/14657031" } ] }, { "title": "The regulated association of Cdt1 with minichromosome maintenance proteins and Cdc6 in mammalian cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Cook JG, Chasse DA, Nevins JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "14672932", "url": "https://glygen.org/publication/PubMed/14672932" } ] }, { "title": "Identification of an autoregulatory feedback pathway involving interleukin-1alpha in induction of constitutive NF-kappaB activation in pancreatic cancer cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Niu J, Li Z, Peng B, Chiao PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "14679213", "url": "https://glygen.org/publication/PubMed/14679213" } ] }, { "title": "Proteasome and peptidase function in MHC-class-I-mediated antigen presentation.", "journal": "Current opinion in immunology", "date": "2004", "authors": "Kloetzel PM, Ossendorp F", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "14734113", "url": "https://glygen.org/publication/PubMed/14734113" } ] }, { "title": "The tumour suppressor RASSF1A regulates mitosis by inhibiting the APC-Cdc20 complex.", "journal": "Nature cell biology", "date": "2004", "authors": "Song MS, Song SJ, Ayad NG, Chang JS, Lee JH, Hong HK, Lee H, Choi N, Kim J, Kim H, Kim JW, Choi EJ, Kirschner MW, Lim DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-176408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176408" } ], "reference": [ { "type": "PubMed", "id": "14743218", "url": "https://glygen.org/publication/PubMed/14743218" } ] }, { "title": "Degradation of the SCF component Skp2 in cell-cycle phase G1 by the anaphase-promoting complex.", "journal": "Nature", "date": "2004", "authors": "Wei W, Ayad NG, Wan Y, Zhang GJ, Kirschner MW, Kaelin WG Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178" } ], "reference": [ { "type": "PubMed", "id": "15014503", "url": "https://glygen.org/publication/PubMed/15014503" } ] }, { "title": "Mammalian Cdh1/Fzr mediates its own degradation.", "journal": "The EMBO journal", "date": "2004", "authors": "Listovsky T, Oren YS, Yudkovsky Y, Mahbubani HM, Weiss AM, Lebendiker M, Brandeis M", "evidence": [ { "database": "Reactome", "id": "R-HSA-174084", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174084" } ], "reference": [ { "type": "PubMed", "id": "15029244", "url": "https://glygen.org/publication/PubMed/15029244" } ] }, { "title": "Generation of major histocompatibility complex class I antigens: functional interplay between proteasomes and TPPII.", "journal": "Nature immunology", "date": "2004", "authors": "Kloetzel PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "15224091", "url": "https://glygen.org/publication/PubMed/15224091" } ] }, { "title": "Post-proteasomal antigen processing for major histocompatibility complex class I presentation.", "journal": "Nature immunology", "date": "2004", "authors": "Rock KL, York IA, Goldberg AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "15224092", "url": "https://glygen.org/publication/PubMed/15224092" } ] }, { "title": "An Rb-Skp2-p27 pathway mediates acute cell cycle inhibition by Rb and is retained in a partial-penetrance Rb mutant.", "journal": "Molecular cell", "date": "2004", "authors": "Ji P, Jiang H, Rekhtman K, Bloom J, Ichetovkin M, Pagano M, Zhu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178" } ], "reference": [ { "type": "PubMed", "id": "15469821", "url": "https://glygen.org/publication/PubMed/15469821" } ] }, { "title": "The proteasome and MHC class I antigen processing.", "journal": "Biochimica et biophysica acta", "date": "2004", "authors": "Kloetzel PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "15571818", "url": "https://glygen.org/publication/PubMed/15571818" } ] }, { "title": "The anaphase-promoting complex: a key factor in the regulation of cell cycle.", "journal": "Oncogene", "date": "2005", "authors": "Castro A, Bernis C, Vigneron S, Labbe JC, Lorca T", "evidence": [ { "database": "Reactome", "id": "R-HSA-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178" } ], "reference": [ { "type": "PubMed", "id": "15678131", "url": "https://glygen.org/publication/PubMed/15678131" } ] }, { "title": "Dissociation of cohesin from chromosome arms and loss of arm cohesion during early mitosis depends on phosphorylation of SA2.", "journal": "PLoS biology", "date": "2005", "authors": "Hauf S, Roitinger E, Koch B, Dittrich CM, Mechtler K, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "15737063", "url": "https://glygen.org/publication/PubMed/15737063" } ] }, { "title": "Histone methyltransferases G9a and GLP form heteromeric complexes and are both crucial for methylation of euchromatin at H3-K9.", "journal": "Genes & development", "date": "2005", "authors": "Tachibana M, Ueda J, Fukuda M, Takeda N, Ohta T, Iwanari H, Sakihama T, Kodama T, Hamakubo T, Shinkai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "15774718", "url": "https://glygen.org/publication/PubMed/15774718" } ] }, { "title": "Localization of the coactivator Cdh1 and the cullin subunit Apc2 in a cryo-electron microscopy model of vertebrate APC/C.", "journal": "Mol. Cell", "date": "2005", "authors": "Herzog F., Dube P., Engel A., Gieffers C., Mueller S.A., Peters J.-M., Riedel D., Sander B., Stark H.", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "reference": [ { "type": "PubMed", "id": "16364912", "url": "https://glygen.org/publication/PubMed/16364912" } ] }, { "title": "The processivity of multiubiquitination by the APC determines the order of substrate degradation.", "journal": "Cell", "date": "2006", "authors": "Rape M, Reddy SK, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178" } ], "reference": [ { "type": "PubMed", "id": "16413484", "url": "https://glygen.org/publication/PubMed/16413484" } ] }, { "title": "Phosphoproteome analysis of the human mitotic spindle.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "Q13042-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042-1" } ], "reference": [ { "type": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" } ] }, { "title": "Pleiotropic effects of ATP.Mg2+ binding in the catalytic cycle of ubiquitin-activating enzyme.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Tokgoz Z, Bohnsack RN, Haas AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "16595681", "url": "https://glygen.org/publication/PubMed/16595681" } ] }, { "title": "The MAP kinase ERK5 binds to and phosphorylates p90 RSK.", "journal": "Archives of biochemistry and biophysics", "date": "2006", "authors": "Ranganathan A, Pearson GW, Chrestensen CA, Sturgill TW, Cobb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "16626623", "url": "https://glygen.org/publication/PubMed/16626623" } ] }, { "title": "Early mitotic degradation of Nek2A depends on Cdc20-independent interaction with the APC/C.", "journal": "Nature cell biology", "date": "2006", "authors": "Hayes MJ, Kimata Y, Wattam SL, Lindon C, Mao G, Yamano H, Fry AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-179409", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-179409" } ], "reference": [ { "type": "PubMed", "id": "16648845", "url": "https://glygen.org/publication/PubMed/16648845" } ] }, { "title": "Reconstitution of Saccharomyces cerevisiae prereplicative complex assembly in vitro.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2006", "authors": "Kawasaki Y, Kim HD, Kojima A, Seki T, Sugino A", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "16824194", "url": "https://glygen.org/publication/PubMed/16824194" } ] }, { "title": "Tripeptidyl peptidase II is the major peptidase needed to trim long antigenic precursors, but is not required for most MHC class I antigen presentation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "York IA, Bhutani N, Zendzian S, Goldberg AL, Rock KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "16849449", "url": "https://glygen.org/publication/PubMed/16849449" } ] }, { "title": "A novel family of membrane-bound E3 ubiquitin ligases.", "journal": "Journal of biochemistry", "date": "2006", "authors": "Ohmura-Hoshino M, Goto E, Matsuki Y, Aoki M, Mito M, Uematsu M, Hotta H, Ishido S", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "16954532", "url": "https://glygen.org/publication/PubMed/16954532" } ] }, { "title": "A probability-based approach for high-throughput protein phosphorylation analysis and site localization.", "journal": "Nature biotechnology", "date": "2006", "authors": "Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" }, { "database": "UniProtKB", "id": "Q5T8C6", "url": "https://www.uniprot.org/uniprot/Q5T8C6" }, { "database": "iPTMnet", "id": "Q13042-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042-1" } ], "reference": [ { "type": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" } ] }, { "title": "Retinoblastoma protein and anaphase-promoting complex physically interact and functionally cooperate during cell-cycle exit.", "journal": "Nature cell biology", "date": "2007", "authors": "Binne UK, Classon MK, Dick FA, Wei W, Rape M, Kaelin WG Jr, Naar AM, Dyson NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-174178", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178" } ], "reference": [ { "type": "PubMed", "id": "17187060", "url": "https://glygen.org/publication/PubMed/17187060" } ] }, { "title": "The APC/C inhibitor, Emi1, is essential for prevention of rereplication.", "journal": "Genes & development", "date": "2007", "authors": "Machida YJ, Dutta A", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "17234884", "url": "https://glygen.org/publication/PubMed/17234884" } ] }, { "title": "Emi1 is needed to couple DNA replication with mitosis but does not regulate activation of the mitotic APC/C.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Di Fiore B, Pines J", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "17485488", "url": "https://glygen.org/publication/PubMed/17485488" } ] }, { "title": "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.", "journal": "Journal of proteome research", "date": "2008", "authors": "Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "Q13042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042" } ], "reference": [ { "type": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ] }, { "title": "Oncogenic BRAF induces senescence and apoptosis through pathways mediated by the secreted protein IGFBP7.", "journal": "Cell", "date": "2008", "authors": "Wajapeyee N, Serra RW, Zhu X, Mahalingam M, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18267069", "url": "https://glygen.org/publication/PubMed/18267069" } ] }, { "title": "Interleukin 1alpha-induced NFkappaB activation and chemokine mRNA stabilization diverge at IRAK1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Hartupee J, Li X, Hamilton T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18411265", "url": "https://glygen.org/publication/PubMed/18411265" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "Q13042-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042-1" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex.", "journal": "Cell", "date": "2008", "authors": "Jin L, Williamson A, Banerjee S, Philipp I, Rape M", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" }, { "database": "Reactome", "id": "R-HSA-174154", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174154" } ], "reference": [ { "type": "PubMed", "id": "18485873", "url": "https://glygen.org/publication/PubMed/18485873" } ] }, { "title": "Chemokine signaling via the CXCR2 receptor reinforces senescence.", "journal": "Cell", "date": "2008", "authors": "Acosta JC, O'Loghlen A, Banito A, Guijarro MV, Augert A, Raguz S, Fumagalli M, Da Costa M, Brown C, Popov N, Takatsu Y, Melamed J, d'Adda di Fagagna F, Bernard D, Hernando E, Gil J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18555777", "url": "https://glygen.org/publication/PubMed/18555777" } ] }, { "title": "Oncogene-induced senescence relayed by an interleukin-dependent inflammatory network.", "journal": "Cell", "date": "2008", "authors": "Kuilman T, Michaloglou C, Vredeveld LC, Douma S, van Doorn R, Desmet CJ, Aarden LA, Mooi WJ, Peeper DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "18555778", "url": "https://glygen.org/publication/PubMed/18555778" } ] }, { "title": "Structural insights into E1-catalyzed ubiquitin activation and transfer to conjugating enzymes.", "journal": "Cell", "date": "2008", "authors": "Lee I, Schindelin H", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "18662542", "url": "https://glygen.org/publication/PubMed/18662542" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "Q13042-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" }, { "database": "UniProtKB", "id": "Q5T8C6", "url": "https://www.uniprot.org/uniprot/Q5T8C6" }, { "database": "iPTMnet", "id": "Q13042-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042-1" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.", "journal": "The international journal of biochemistry & cell biology", "date": "2009", "authors": "Ebstein F, Lange N, Urban S, Seifert U, Kruger E, Kloetzel PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19028597", "url": "https://glygen.org/publication/PubMed/19028597" } ] }, { "title": "Ubiquitin-like protein activation by E1 enzymes: the apex for downstream signalling pathways.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Schulman BA, Harper JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19352404", "url": "https://glygen.org/publication/PubMed/19352404" } ] }, { "title": "What was the set of ubiquitin and ubiquitin-like conjugating enzymes in the eukaryote common ancestor?", "journal": "Journal of molecular evolution", "date": "2009", "authors": "Michelle C, Vourc'h P, Mignon L, Andres CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19452197", "url": "https://glygen.org/publication/PubMed/19452197" } ] }, { "title": "RING domain E3 ubiquitin ligases.", "journal": "Annual review of biochemistry", "date": "2009", "authors": "Deshaies RJ, Joazeiro CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19489725", "url": "https://glygen.org/publication/PubMed/19489725" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "Q13042-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "Q13042-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042-1" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure.", "journal": "Nat. Struct. Mol. Biol.", "date": "2009", "authors": "Kurinov I., Wang J., Schulman B.A., Rajashankar K.R., Dye B.T.", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "reference": [ { "type": "PubMed", "id": "19668213", "url": "https://glygen.org/publication/PubMed/19668213" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" }, { "database": "iPTMnet", "id": "Q13042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Cell surface-bound IL-1alpha is an upstream regulator of the senescence-associated IL-6/IL-8 cytokine network.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Orjalo AV, Bhaumik D, Gengler BK, Scott GK, Campisi J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "19805069", "url": "https://glygen.org/publication/PubMed/19805069" } ] }, { "title": "Building ubiquitin chains: E2 enzymes at work.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Ye Y, Rape M", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19851334", "url": "https://glygen.org/publication/PubMed/19851334" } ] }, { "title": "Mechanisms of ubiquitin transfer by the anaphase-promoting complex.", "journal": "Journal of biology", "date": "2009", "authors": "Matyskiela ME, Rodrigo-Brenni MC, Morgan DO", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19874575", "url": "https://glygen.org/publication/PubMed/19874575" } ] }, { "title": "Concerted loading of Mcm2-7 double hexamers around DNA during DNA replication origin licensing.", "journal": "Cell", "date": "2009", "authors": "Remus D, Beuron F, Tolun G, Griffith JD, Morris EP, Diffley JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "19896182", "url": "https://glygen.org/publication/PubMed/19896182" } ] }, { "title": "The family of ubiquitin-conjugating enzymes (E2s): deciding between life and death of proteins.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010", "authors": "van Wijk SJ, Timmers HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "19940261", "url": "https://glygen.org/publication/PubMed/19940261" } ] }, { "title": "VentX, a novel lymphoid-enhancing factor/T-cell factor-associated transcription repressor, is a putative tumor suppressor.", "journal": "Cancer research", "date": "2010", "authors": "Gao H, Le Y, Wu X, Silberstein LE, Giese RW, Zhu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-8853884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884" } ], "reference": [ { "type": "PubMed", "id": "20028861", "url": "https://glygen.org/publication/PubMed/20028861" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" }, { "database": "iPTMnet", "id": "Q13042-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "RSK-mediated phosphorylation in the C/EBP{beta} leucine zipper regulates DNA binding, dimerization, and growth arrest activity.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Lee S, Shuman JD, Guszczynski T, Sakchaisri K, Sebastian T, Copeland TD, Miller M, Cohen MS, Taunton J, Smart RC, Xiao Z, Yu LR, Veenstra TD, Johnson PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "20351173", "url": "https://glygen.org/publication/PubMed/20351173" } ] }, { "title": "CCAAT/Enhancer-binding protein beta DNA binding is auto-inhibited by multiple elements that also mediate association with p300/CREB-binding protein (CBP).", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Lee S, Miller M, Shuman JD, Johnson PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "20452968", "url": "https://glygen.org/publication/PubMed/20452968" } ] }, { "title": "VentX trans-activates p53 and p16ink4a to regulate cellular senescence.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Wu X, Gao H, Ke W, Hager M, Xiao S, Freeman MR, Zhu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-8853884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884" } ], "reference": [ { "type": "PubMed", "id": "21325273", "url": "https://glygen.org/publication/PubMed/21325273" } ] }, { "title": "The homeobox transcription factor VentX controls human macrophage terminal differentiation and proinflammatory activation.", "journal": "The Journal of clinical investigation", "date": "2011", "authors": "Wu X, Gao H, Ke W, Giese RW, Zhu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-8853884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884" } ], "reference": [ { "type": "PubMed", "id": "21670496", "url": "https://glygen.org/publication/PubMed/21670496" } ] }, { "title": "Activation of interleukin-6 gene expression through the NF-kappa B transcription factor.", "journal": "Molecular and cellular biology", "date": "1990", "authors": "Libermann TA, Baltimore D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "2183031", "url": "https://glygen.org/publication/PubMed/2183031" } ] }, { "title": "Control of the senescence-associated secretory phenotype by NF-kappaB promotes senescence and enhances chemosensitivity.", "journal": "Genes & development", "date": "2011", "authors": "Chien Y, Scuoppo C, Wang X, Fang X, Balgley B, Bolden JE, Premsrirut P, Luo W, Chicas A, Lee CS, Kogan SC, Lowe SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "21979375", "url": "https://glygen.org/publication/PubMed/21979375" } ] }, { "title": "Systematic phosphorylation analysis of human mitotic protein complexes.", "journal": "Science signaling", "date": "2011", "authors": "Hegemann B, Hutchins JR, Hudecz O, Novatchkova M, Rameseder J, Sykora MM, Liu S, Mazanek M, Lenart P, Heriche JK, Poser I, Kraut N, Hyman AA, Yaffe MB, Mechtler K, Peters JM", "evidence": [ { "database": "iPTMnet", "id": "Q13042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042" } ], "reference": [ { "type": "PubMed", "id": "22067460", "url": "https://glygen.org/publication/PubMed/22067460" } ] }, { "title": "Cell cycle adaptations of embryonic stem cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Ballabeni A, Park IH, Zhao R, Wang W, Lerou PH, Daley GQ, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-176407", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176407" } ], "reference": [ { "type": "PubMed", "id": "22084091", "url": "https://glygen.org/publication/PubMed/22084091" } ] }, { "title": "DNA damage signaling triggers degradation of histone methyltransferases through APC/C(Cdh1) in senescent cells.", "journal": "Molecular cell", "date": "2012", "authors": "Takahashi A, Imai Y, Yamakoshi K, Kuninaka S, Ohtani N, Yoshimoto S, Hori S, Tachibana M, Anderton E, Takeuchi T, Shinkai Y, Peters G, Saya H, Hara E", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "22178396", "url": "https://glygen.org/publication/PubMed/22178396" } ] }, { "title": "Molecular cloning and primary structure of rat testes metalloendopeptidase EC 3.4.24.15.", "journal": "Biochemistry", "date": "1990", "authors": "Pierotti A, Dong KW, Glucksman MJ, Orlowski M, Roberts JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "2261476", "url": "https://glygen.org/publication/PubMed/2261476" } ] }, { "title": "A polymorphism in the upstream regulatory region of the interleukin-1alpha gene confers differential binding by transcription factors of the AP-1 family.", "journal": "Life sciences", "date": "2012", "authors": "Moerman-Herzog AM, Barger SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "22634325", "url": "https://glygen.org/publication/PubMed/22634325" } ] }, { "title": "HDAC8 mutations in Cornelia de Lange syndrome affect the cohesin acetylation cycle.", "journal": "Nature", "date": "2012", "authors": "Deardorff MA, Bando M, Nakato R, Watrin E, Itoh T, Minamino M, Saitoh K, Komata M, Katou Y, Clark D, Cole KE, De Baere E, Decroos C, Di Donato N, Ernst S, Francey LJ, Gyftodimou Y, Hirashima K, Hullings M, Ishikawa Y, Jaulin C, Kaur M, Kiyono T, Lombardi PM, Magnaghi-Jaulin L, Mortier GR, Nozaki N, Petersen MB, Seimiya H, Siu VM, Suzuki Y, Takagaki K, Wilde JJ, Willems PJ, Prigent C, Gillessen-Kaesbach G, Christianson DW, Kaiser FJ, Jackson LG, Hirota T, Krantz ID, Shirahige K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "22885700", "url": "https://glygen.org/publication/PubMed/22885700" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" }, { "database": "iPTMnet", "id": "Q13042", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13042" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "An ORC/Cdc6/MCM2-7 complex is formed in a multistep reaction to serve as a platform for MCM double-hexamer assembly.", "journal": "Molecular cell", "date": "2013", "authors": "Fernandez-Cid A, Riera A, Tognetti S, Herrera MC, Samel S, Evrin C, Winkler C, Gardenal E, Uhle S, Speck C", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "23603117", "url": "https://glygen.org/publication/PubMed/23603117" } ] }, { "title": "N-myc downstream-regulated gene 1 promotes tumor inflammatory angiogenesis through JNK activation and autocrine loop of interleukin-1alpha by human gastric cancer cells.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Murakami Y, Watari K, Shibata T, Uba M, Ureshino H, Kawahara A, Abe H, Izumi H, Mukaida N, Kuwano M, Ono M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "23846687", "url": "https://glygen.org/publication/PubMed/23846687" } ] }, { "title": "Cryo-EM structure of a helicase loading intermediate containing ORC-Cdc6-Cdt1-MCM2-7 bound to DNA.", "journal": "Nature structural & molecular biology", "date": "2013", "authors": "Sun J, Evrin C, Samel SA, Fernandez-Cid A, Riera A, Kawakami H, Stillman B, Speck C, Li H", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "23851460", "url": "https://glygen.org/publication/PubMed/23851460" } ] }, { "title": "Involvement of a NF-kappa B-like transcription factor in the activation of the interleukin-6 gene by inflammatory lymphokines.", "journal": "Molecular and cellular biology", "date": "1990", "authors": "Shimizu H, Mitomo K, Watanabe T, Okamoto S, Yamamoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "2405250", "url": "https://glygen.org/publication/PubMed/2405250" } ] }, { "title": "Homeobox transcription factor VentX regulates differentiation and maturation of human dendritic cells.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Wu X, Gao H, Bleday R, Zhu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "24706756", "url": "https://glygen.org/publication/PubMed/24706756" } ] }, { "title": "Molecular architecture and mechanism of the anaphase-promoting complex.", "journal": "Nature", "date": "2014", "authors": "Yang J., Zhang Z., Chang L., Barford D., McLaughlin S.H.", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "reference": [ { "type": "PubMed", "id": "25043029", "url": "https://glygen.org/publication/PubMed/25043029" } ] }, { "title": "Geminin inhibits a late step in the formation of human pre-replicative complexes.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Wu M, Lu W, Santos RE, Frattini MG, Kelly TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "25231993", "url": "https://glygen.org/publication/PubMed/25231993" } ] }, { "title": "Atomic structure of the APC/C and its mechanism of protein ubiquitination.", "journal": "Nature", "date": "2015", "authors": "Chang L, Zhang Z, Yang J, McLaughlin SH, Barford D", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "reference": [ { "type": "PubMed", "id": "26083744", "url": "https://glygen.org/publication/PubMed/26083744" } ] }, { "title": "Structure of the eukaryotic MCM complex at 3.8 A.", "journal": "Nature", "date": "2015", "authors": "Li N, Zhai Y, Zhang Y, Li W, Yang M, Lei J, Tye BK, Gao N", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "26222030", "url": "https://glygen.org/publication/PubMed/26222030" } ] }, { "title": "Molecular architecture of the recombinant human MCM2-7 helicase in complex with nucleotides and DNA.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2016", "authors": "Boskovic J, Bragado-Nilsson E, Saligram Prabhakar B, Yefimenko I, Martinez-Gago J, Munoz S, Mendez J, Montoya G", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "27249176", "url": "https://glygen.org/publication/PubMed/27249176" } ] }, { "title": "A homozygous loss-of-function mutation in FBXO43 causes human non-obstructive azoospermia.", "journal": "Clin. Genet.", "date": "2022", "authors": "Wu H, Zhang X, Shen Q, Liu Y, Gao Y, Wang G, Lv M, Hua R, Xu Y, Zhou P, Wei Z, Tao F, He X, Cao Y, Liu M", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "reference": [ { "type": "PubMed", "id": "34595750", "url": "https://glygen.org/publication/PubMed/34595750" } ] }, { "title": "DEPDC1B Promotes Melanoma Angiogenesis and Metastasis through Sequestration of Ubiquitin Ligase CDC16 to Stabilize Secreted SCUBE3.", "journal": "Advanced science (Weinheim, Baden-Wurttemberg, Germany)", "date": "2022", "authors": "Hu F, Fong KO, Cheung MPL, Liu JA, Liang R, Li TW, Sharma R, Ip PP, Yang X, Cheung M", "evidence": [ { "database": "RefSeq", "id": "NP_001072113", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001072113" } ], "reference": [ { "type": "PubMed", "id": "35088579", "url": "https://glygen.org/publication/PubMed/35088579" } ] }, { "title": "CDC27Hs colocalizes with CDC16Hs to the centrosome and mitotic spindle and is essential for the metaphase to anaphase transition.", "journal": "Cell", "date": "1995", "authors": "Hieter P., Tugendreich S., Earnshaw W., Tomkiel J.", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "reference": [ { "type": "PubMed", "id": "7736578", "url": "https://glygen.org/publication/PubMed/7736578" } ] }, { "title": "Transcription factors NF-IL6 and NF-kappa B synergistically activate transcription of the inflammatory cytokines, interleukin 6 and interleukin 8.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Matsusaka T, Fujikawa K, Nishio Y, Mukaida N, Matsushima K, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8234276", "url": "https://glygen.org/publication/PubMed/8234276" } ] }, { "title": "Phosphorylation at threonine-235 by a ras-dependent mitogen-activated protein kinase cascade is essential for transcription factor NF-IL6.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Nakajima T, Kinoshita S, Sasagawa T, Sasaki K, Naruto M, Kishimoto T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8384717", "url": "https://glygen.org/publication/PubMed/8384717" } ] }, { "title": "NF-kappa B subunit-specific regulation of the interleukin-8 promoter.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Kunsch C, Rosen CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8413215", "url": "https://glygen.org/publication/PubMed/8413215" } ] }, { "title": "Distinct mechanisms for regulation of the interleukin-8 gene involve synergism and cooperativity between C/EBP and NF-kappa B.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Stein B, Baldwin AS Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8413306", "url": "https://glygen.org/publication/PubMed/8413306" } ] }, { "title": "Interleukin-1 alpha activates an NF-kappaB-like factor in osteoclast-like cells.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Jimi E, Ikebe T, Takahashi N, Hirata M, Suda T, Koga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8617720", "url": "https://glygen.org/publication/PubMed/8617720" } ] }, { "title": "The transcription factor AP-1 binds to the human interleukin 1 alpha promoter.", "journal": "European cytokine network", "date": "1996", "authors": "Bailly S, Fay M, Israel N, Gougerot-Pocidalo MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8688489", "url": "https://glygen.org/publication/PubMed/8688489" } ] }, { "title": "Dermatotoxic chemical stimulate of c-jun and c-fos transcription and AP-1 DNA binding in human keratinocytes.", "journal": "Research communications in molecular pathology and pharmacology", "date": "1996", "authors": "Burleson FG, Simeonova PP, Germolec DR, Luster MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8884985", "url": "https://glygen.org/publication/PubMed/8884985" } ] }, { "title": "An AP-1 site is involved in the NGF induction of IL-1 alpha in PC12 cells.", "journal": "Neurochemistry international", "date": "1996", "authors": "Alheim K, McDowell TL, Symons JA, Duff GW, Bartfai T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2559582", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582" } ], "reference": [ { "type": "PubMed", "id": "8939459", "url": "https://glygen.org/publication/PubMed/8939459" } ] }, { "title": "Two distinct proteolytic processes in the generation of a major histocompatibility complex class I-presented peptide.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Craiu A, Akopian T, Goldberg A, Rock KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "9380723", "url": "https://glygen.org/publication/PubMed/9380723" } ] }, { "title": "The serine/threonine phosphatase PP5 interacts with CDC16 and CDC27, two tetratricopeptide repeat-containing subunits of the anaphase-promoting complex.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Donoghue D.J., Ollendorff V.", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "reference": [ { "type": "PubMed", "id": "9405394", "url": "https://glygen.org/publication/PubMed/9405394" } ] }, { "title": "Mammalian p55CDC mediates association of the spindle checkpoint protein Mad2 with the cyclosome/anaphase-promoting complex, and is involved in regulating anaphase onset and late mitotic events.", "journal": "J. Cell Biol.", "date": "1998", "authors": "Daum J.R., Gorbsky G.J., Burke D.J., Kallio M., Weinstein J.", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "reference": [ { "type": "PubMed", "id": "9628895", "url": "https://glygen.org/publication/PubMed/9628895" } ] }, { "title": "Geminin, an inhibitor of DNA replication, is degraded during mitosis.", "journal": "Cell", "date": "1998", "authors": "McGarry TJ, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-68867", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867" } ], "reference": [ { "type": "PubMed", "id": "9635433", "url": "https://glygen.org/publication/PubMed/9635433" } ] }, { "title": "Interferon-gamma can stimulate post-proteasomal trimming of the N terminus of an antigenic peptide by inducing leucine aminopeptidase.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Beninga J, Rock KL, Goldberg AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168" } ], "reference": [ { "type": "PubMed", "id": "9668046", "url": "https://glygen.org/publication/PubMed/9668046" } ] }, { "title": "Structure, expression, and function of human pituitary tumor-transforming gene (PTTG).", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1999", "authors": "Zhang X, Horwitz GA, Prezant TR, Valentini A, Nakashima M, Bronstein MD, Melmed S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "9892021", "url": "https://glygen.org/publication/PubMed/9892021" } ] } ], "pathway": [ { "id": "hsa:8881", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8881", "resource": "KEGG Pathway" }, { "id": "R-HSA-141430", "name": "Inactivation of APC/C via direct inhibition of the APC/C complex", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141430", "resource": "Reactome", "description": "Inactivation of APC/C via direct inhibition of the APC/C complex" }, { "id": "R-HSA-174048", "name": "APC/C:Cdc20 mediated degradation of Cyclin B", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174048", "resource": "Reactome", "description": "APC/C:Cdc20 mediated degradation of Cyclin B" }, { "id": "R-HSA-174084", "name": "Autodegradation of Cdh1 by Cdh1:APC/C", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174084", "resource": "Reactome", "description": "Autodegradation of Cdh1 by Cdh1:APC/C" }, { "id": "R-HSA-174154", "name": "APC/C:Cdc20 mediated degradation of Securin", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174154", "resource": "Reactome", "description": "APC/C:Cdc20 mediated degradation of Securin" }, { "id": "R-HSA-174178", "name": "APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178", "resource": "Reactome", "description": "APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1" }, { "id": "R-HSA-174184", "name": "Cdc20:Phospho-APC/C mediated degradation of Cyclin A", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174184", "resource": "Reactome", "description": "Cdc20:Phospho-APC/C mediated degradation of Cyclin A" }, { "id": "R-HSA-176407", "name": "Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176407", "resource": "Reactome", "description": "Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase" }, { "id": "R-HSA-176408", "name": "Regulation of APC/C activators between G1/S and early anaphase", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176408", "resource": "Reactome", "description": "Regulation of APC/C activators between G1/S and early anaphase" }, { "id": "R-HSA-176409", "name": "APC/C:Cdc20 mediated degradation of mitotic proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176409", "resource": "Reactome", "description": "APC/C:Cdc20 mediated degradation of mitotic proteins" }, { "id": "R-HSA-176412", "name": "Phosphorylation of the APC/C", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-176412", "resource": "Reactome", "description": "Phosphorylation of the APC/C" }, { "id": "R-HSA-179409", "name": "APC-Cdc20 mediated degradation of Nek2A", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-179409", "resource": "Reactome", "description": "APC-Cdc20 mediated degradation of Nek2A" }, { "id": "R-HSA-2467813", "name": "Separation of Sister Chromatids", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813", "resource": "Reactome", "description": "Separation of Sister Chromatids" }, { "id": "R-HSA-2559582", "name": "Senescence-Associated Secretory Phenotype (SASP)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2559582", "resource": "Reactome", "description": "Senescence-Associated Secretory Phenotype (SASP)" }, { "id": "R-HSA-68867", "name": "Assembly of the pre-replicative complex", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68867", "resource": "Reactome", "description": "Assembly of the pre-replicative complex" }, { "id": "R-HSA-69017", "name": "CDK-mediated phosphorylation and removal of Cdc6", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017", "resource": "Reactome", "description": "CDK-mediated phosphorylation and removal of Cdc6" }, { "id": "R-HSA-8853884", "name": "Transcriptional Regulation by VENTX", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8853884", "resource": "Reactome", "description": "Transcriptional Regulation by VENTX" }, { "id": "R-HSA-9687136", "name": "Aberrant regulation of mitotic exit in cancer due to RB1 defects", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9687136", "resource": "Reactome", "description": "Aberrant regulation of mitotic exit in cancer due to RB1 defects" }, { "id": "R-HSA-983168", "name": "Antigen processing: Ubiquitination & Proteasome degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168", "resource": "Reactome", "description": "Antigen processing: Ubiquitination & Proteasome degradation" } ], "orthologs": [ { "uniprot_canonical_ac": "P09798-1", "protein_name": "Anaphase-promoting complex subunit CDC16", "gene_name": "CDC16", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MKFCLYCCHCYIVICGKATHYYKSSKATSNLKSSNRVLMRNPMSPSEQHSQHNSTLAASPFVSNVSAARTQQSLPTDAQNDRLQQPWNRTNTATSPYQSLANSPLIQKLQANIMTPHQPSANSNSNSNSITGNVVNDNNLLASMSKNSMFGSTIPSTLRKVSLQREYKDSVDGVVRDEDNDEDVHNNGDAAANANNDRESKLGHNGPLTTTTLTTTTTATQLDVSELSAIERLRLWRFDALMQHMYRTAEYIADKVYNISNDPDDAFWLGQVYYNNNQYVRAVELITRNNLDGVNILCRYLLGLSFVKLQRFDDALDVIGEYNPFSEDPSTTAANTMSNNGNNSNTSQPVTDGGIKMESSLCFLRGKIYFAQNNFNKARDAFREAILVDIKNFEAFEMLLSKNLLTPQEEWDLFDSLDFKEFGEDKEIMKNLYKINLSKYINTEDITKSNEILAKDYKLADNVDVVRSKVDICYTQCKFNECLELCETVLENDEFNTNILPAYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSATALLKNALELNVTLSLDASHPLIDKSNLMSQASKDKASLNKKRSSLTYDPVNMAKRLRTQKEIFDQNNKALRKGGHDSKTGSNNADDDFDADMELE", "length": 840 }, "evidence": [ { "id": "Q13042", "url": "https://omabrowser.org/oma/group/Q13042/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q4V884-1", "protein_name": "CDC16 cell division cycle 16 homolog (S. cerevisiae)", "gene_name": "Cdc16", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MNLEPLRKRVRQYLDQQQYQSALFWADKVASLSHEEPQDVYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEYQQALDILDMEEPINRRLFEKYLKDDSGSKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLDSLPLSKLCAEEQELLRFVFENKLKKYNKPSETVIPQSVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSAVMEKDPFHANCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFGQALSIAPEDPFVIHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFRDFEVEKQNTEEAGLAPLENATKTPESRPSLEETFEIEMNESDMMLETSMSDHST", "length": 620 }, "evidence": [ { "id": "45228998", "url": "http://www.informatics.jax.org/homology/45228998", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8R349-1", "protein_name": "Cell division cycle protein 16 homolog", "gene_name": "Cdc16", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNLEPLRKRVRQYLDQQQYQSALFWADKVASLSHEEPQDVYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDILDMEEPINRRLFEKYLKDDNGSRDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLDSLPLNKLCAEEQELLRFVFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSTVMEKDPFHANCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFGQALSIAPEDPFVIHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFRDFEVEKQNTEEAGLAPLQNSTKAPESRPNLEETFEIEMNESDMMLETSMSDHST", "length": 620 }, "evidence": [ { "id": "45228998", "url": "http://www.informatics.jax.org/homology/45228998", "database": "MGI" }, { "id": "Q13042", "url": "https://omabrowser.org/oma/group/Q13042/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "pmid": "" }, { "name": "centrosome", "id": "GO:0005813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005813", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "pmid": "" }, { "name": "anaphase-promoting complex", "id": "GO:0005680", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005680", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "pmid": "" }, { "name": "mitotic spindle", "id": "GO:0072686", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072686", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "cell division", "id": "GO:0051301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "pmid": "" }, { "name": "regulation of mitotic cell cycle", "id": "GO:0007346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007346", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "pmid": "" }, { "name": "protein ubiquitination", "id": "GO:0016567", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "pmid": "" }, { "name": "cell cycle", "id": "GO:0007049", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007049", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "pmid": "" }, { "name": "anaphase-promoting complex-dependent catabolic process", "id": "GO:0031145", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031145", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "pmid": "" }, { "name": "protein K11-linked ubiquitination", "id": "GO:0070979", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070979", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "pmid": "" }, { "name": "positive regulation of mitotic metaphase/anaphase transition", "id": "GO:0045842", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045842", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "pmid": "" }, { "name": "regulation of meiotic cell cycle", "id": "GO:0051445", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051445", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 145, "end_pos": 147, "annotation": "n_glycosylation_sequon" }, { "start_pos": 382, "end_pos": 384, "annotation": "n_glycosylation_sequon" }, { "start_pos": 478, "end_pos": 480, "annotation": "n_glycosylation_sequon" }, { "start_pos": 605, "end_pos": 607, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated. Phosphorylation on Ser-560 occurs specifically during mitosis.", "evidence": [ { "database": "UniProtKB", "id": "Q13042", "url": "https://www.uniprot.org/uniprot/Q13042" }, { "database": "PubMed", "id": "14657031", "url": "https://glygen.org/publication/PubMed/14657031" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 126 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }